| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp144144-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $49.90 | |
| rp144144-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $129.90 | |
| rp144144-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $199.90 | |
| rp144144-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,499.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 26-247 aa
| Product Name | Recombinant Human B7-2/CD86 Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | Activation B7-2 antigen; Activation B7-2 antigen 3; B-lymphocyte activation antigen B7-2; B-lymphocyte activation antigen B7-2 2; B7; B7 2; B7-2; B7.2; B70; B72; B72 antigen; BU63; CD28 antigen ligand 2; CD28 antigen ligand 2 2; Cd28l2; CD28LG2; CD86; CD8 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human CD86 at 2 μg/mL (100 μL/well) can bind Recombinant Human CTLA-4 with a linear range of 10-40 ng/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 26-247 aa |
| Sequence | LKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPHHHHHH |
| Protein Tag | C-His |
| Accession # | P42081 |
| Predicted molecular weight | 25 kDa |
| SDS-PAGE | 40.0 - 60.0 kDa, under reducing conditions; 40.0 - 60.0 kDa, under non-reducing conditions. |
Recombinant Human B7-2/CD86 Protein (rp144144) - Protein Bioactivity
Immobilized Recombinant Human B7-2/CD86 Protein (rp144144) at 2.0 µg/mL can bind Recombinant Human CTLA-4 with a linear range of 10 - 40 ng/mL.
Recombinant Human B7-2/CD86 Protein (rp144144) - SDS-PAGE
3 μg/lane of Recombinant Human B7-2/CD86 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 40.0 - 60.0 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0404960 | Certificate of Analysis | Apr 30, 2024 | rp144144 |
| ZJ24F0404959 | Certificate of Analysis | Apr 30, 2024 | rp144144 |
| ZJ24F0404958 | Certificate of Analysis | Apr 30, 2024 | rp144144 |
