Recombinant Human B7-H3(4Ig)/B7-H3b Protein, >95% (SDS-PAGE), high purity

Item Number

rp176244

• Product Name: Recombinant Human B7-H3(4Ig)/B7-H3b Protein, >95% (SDS-PAGE), high purity
• Synonyms: 4Ig-B7-H3 | B7 homolog 3 | B7-H3 | Costimulatory molecule | 4Ig B7 H3 | 4Ig-B7-H3 | B7H34Ig-B7-H3 | B7-H3B7 homolog 3 | AU016588 | B7 H3 | B7 homolog 3 | B7-H3 | B7H3 | B7RP-2 | CD_antigen=CD276 | CD276 | CD276 antigen | CD276 molecule | CD276_HUMAN | Cos
• Grade: ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
• Specifications & Purity: ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
• Purity: >95% (SDS-PAGE)
• Bioactivity: 1、Measured by its binding ability in a functional ELISA. Immobilized CD276 mouse mAb at 1.0 μg/mL can bind Recombinant Human B7-H3 (4Ig)/B7-H3b Protein (rp176244) with the EC50 of 51.95 ng/mL. 2、Measured by its binding ability in a functional ELISA. Immo
• Endotoxin Concentration: ＜1.0 EU/μg
• Expression System: HEK293
• Amino Acids: 29-461 aa
• Sequence: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNL
• Protein Tag: C-His
• N-terminal Sequence: Gly27
• Predicted molecular weight: 47.9 kDa
• SDS-PAGE: 63.2-82.3 kDa, under reducing conditions; 58.6-73.9 kDa, under non-reducing condition

Product Description

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
Human B7 homolog 3 (B7-H3) is a member of the B7 family of immune proteins that provide signals for the regulation of immune responses. Other family members include B7-1, B7-2, B7-H1/PD-L1, B7-H2, and PD-L2. B7 family proteins are type I transmembrane immunoglobulin (Ig) superfamily members that contain extracellular Ig V‑like and Ig C‑like domains with a short cytoplasmic tail. Among the family members there is about 20 - 40% amino acid (aa) sequence identity. B7-H3 was initially reported to be a 316 aa type I transmembrane precursor protein that contained a signal sequence, an extracellular region with one V‑type and one C‑type Ig domain, a transmembrane segment and a short cytoplasmic tail. Subsequent studies have identified a second 110 kDa form whose precursor is 534 aa in length. Termed 4IgB7-H3 or B7-H3b, this molecule has two additional Ig-like domains (one V‑type and one C‑type) and shows a ubiquituous expression pattern. It would appear that the human 4Ig form is the principal, if not the only form of B7-H3. Its precursor contains a 26 aa signal sequence, a 435 aa extracellular region, a 31 aa transmembrane domain, and a 42 aa cytoplasmic tail. The four Ig-like domains alternate between V‑type and C‑type, and apparently are the consequence of a V‑C type tandem duplication. B7-H3b is expressed on dendritic cells as well as activated T, B and NK cells. The mouse gene differs from that of human in that it cannot code for four Ig-like domains; only a V‑type:C‑type pair. Human B7-H3b binding to an undefined receptor has shown to be inhibitory to NK cell illing and cytokine release. It also seems to be required for late stage osteoblast differentiation.