Skip to the beginning of the images gallery

Recombinant Human B7-H3(4Ig)/B7-H3b Protein, >95% (SDS-PAGE), high purity

≥95%(SDS-PAGE)

Features and benefits

Expression System: HEK293
Protein Tag: C-His
Bioactivity: 1、Measured by its binding ability in a functional ELISA. Immobilized CD276 mouse mAb at 1.0 μg/mL can bind Recombinant Human B7-H3 (4Ig)/B7-H3b Protein (rp176244) with the EC50 of 51.95 ng/mL. 2、Measured by its binding ability in a functional ELISA. Immo
Endotoxin Concentration: ＜1.0 EU/μg

Item Number

rp176244

Grouped product items
SKU	Size	Availability	Price
rp176244-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free!	10μg	In stock	$89.90
rp176244-50μg	50μg	In stock	$259.90
rp176244-100μg	100μg	In stock	$399.90
rp176244-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,199.90

Animal Free, >95% (SDS-PAGE), Active, 293F cell, His tag, 29-461 aa

View related series

Accession#:Q5ZPR3 B7-H3 (4Ig) B7-H3b CD276 Gene ID:80381

Basic Description

Product Name	Recombinant Human B7-H3(4Ig)/B7-H3b Protein, >95% (SDS-PAGE), high purity
Synonyms	4Ig-B7-H3 \| B7 homolog 3 \| B7-H3 \| Costimulatory molecule
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description	Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining Description: Human B7 homolog 3 (B7-H3) is a member of the B7 family of immune proteins that provide signals for the regulation of immune responses. Other family members include B7-1, B7-2, B7-H1/PD-L1, B7-H2, and PD-L2. B7 family proteins are type I transmembrane immunoglobulin (Ig) superfamily members that contain extracellular Ig V‑like and Ig C‑like domains with a short cytoplasmic tail. Among the family members there is about 20 - 40% amino acid (aa) sequence identity. B7-H3 was initially reported to be a 316 aa type I transmembrane precursor protein that contained a signal sequence, an extracellular region with one V‑type and one C‑type Ig domain, a transmembrane segment and a short cytoplasmic tail. Subsequent studies have identified a second 110 kDa form whose precursor is 534 aa in length. Termed 4IgB7-H3 or B7-H3b, this molecule has two additional Ig-like domains (one V‑type and one C‑type) and shows a ubiquituous expression pattern. It would appear that the human 4Ig form is the principal, if not the only form of B7-H3. Its precursor contains a 26 aa signal sequence, a 435 aa extracellular region, a 31 aa transmembrane domain, and a 42 aa cytoplasmic tail. The four Ig-like domains alternate between V‑type and C‑type, and apparently are the consequence of a V‑C type tandem duplication. B7-H3b is expressed on dendritic cells as well as activated T, B and NK cells. The mouse gene differs from that of human in that it cannot code for four Ig-like domains; only a V‑type:C‑type pair. Human B7-H3b binding to an undefined receptor has shown to be inhibitory to NK cell illing and cytokine release. It also seems to be required for late stage osteoblast differentiation.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	>95% (SDS-PAGE)
Bioactivity	1、Measured by its binding ability in a functional ELISA. Immobilized CD276 mouse mAb at 1.0 μg/mL can bind Recombinant Human B7-H3 (4Ig)/B7-H3b Protein (rp176244) with the EC50 of 51.95 ng/mL. 2、Measured by its binding ability in a functional ELISA. Immo
Endotoxin Concentration	＜1.0 EU/μg
Expression System	HEK293
Amino Acids	29-461 aa
Sequence	LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNL
Protein Tag	C-His
N-terminal Sequence	Gly27
Predicted molecular weight	47.9 kDa
SDS-PAGE	63.2-82.3 kDa, under reducing conditions; 58.6-73.9 kDa, under non-reducing condition

Images

ELISA: Recombinant Human B7-H3(4Ig)/B7-H3b Protein (rp176244)
Measured by its binding ability in a functional ELISA. Immobilized CD276 mouse mAb at 1.0 μg/mL can bind Recombinant Human B7-H3 (4Ig)/B7-H3b Protein (rp176244) with the EC₅₀ of 51.95 ng/mL.

Recombinant Human B7-H3(4Ig)/B7-H3b Protein (rp176244) - ELISA
Measured by its binding ability in a functional ELISA. Immobilized human Human B7-H3 (4Ig)/B7-H3b (rp176244) at 1.0 μg/mL can bind CD276 mouse mAb with the EC₅₀ of 1.86 ng/mL.

Recombinant Human B7-H3(4Ig)/B7-H3b Protein (rp176244) - SDS-PAGE
3 μg/lane of Recombinant Human B7-H3(4Ig)/B7-H3b Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 63.2 - 82.3 kDa under reducing conditions and 58.6 - 73.9 kDa under non-reducing conditions.

Product Specifications

Form	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section

4 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0202914	Certificate of Analysis	Mar 01, 2024	rp176244
ZJ24F0202913	Certificate of Analysis	Mar 01, 2024	rp176244
ZJ24F0202912	Certificate of Analysis	Mar 01, 2024	rp176244
ZJ24R0200289	Certificate of Analysis	Feb 22, 2024	rp176244

References

1. Loo D, Alderson RF, Chen FZ, Huang L, Zhang W, Gorlatov S, Burke S, Ciccarone V, Li H, Yang Y et al.. (2012) Development of an Fc-enhanced anti-B7-H3 monoclonal antibody with potent antitumor activity.. Clin Cancer Res, 18 (14): (3834-45). [PMID:22615450]
2. Chapoval AI, Ni J, Lau JS, Wilcox RA, Flies DB, Liu D, Dong H, Sica GL, Zhu G, Tamada K et al.. (2001) B7-H3: a costimulatory molecule for T cell activation and IFN-gamma production.. Nat Immunol, 2 (3): (269-74). [PMID:11224528]
3. Castriconi R, Dondero A, Augugliaro R, Cantoni C, Carnemolla B, Sementa AR, Negri F, Conte R, Corrias MV, Moretta L et al.. (2004) Identification of 4Ig-B7-H3 as a neuroblastoma-associated molecule that exerts a protective role from an NK cell-mediated lysis.. Proc Natl Acad Sci USA, 101 (34): (12640-5). [PMID:15314238]
4. Ling, Vincent V and 6 more authors.. (2003) Duplication of primate and rodent B7-H3 immunoglobulin V- and C-like domains: divergent history of functional redundancy and exon loss.. Genomics, [PMID:12906861]
5. Steinberger, Peter P and 9 more authors.. (2004) Molecular characterization of human 4Ig-B7-H3, a member of the B7 family with four Ig-like domains.. Journal of immunology (Baltimore, Md. : 1950), (15): [PMID:14764704]
6. Wang, Liqing L and 7 more authors.. (2005) B7-H3 promotes acute and chronic allograft rejection.. European journal of immunology, [PMID:15682454]
7. Kim, Jean J and 8 more authors.. (2005) Constitutive and inducible expression of b7 family of ligands by human airway epithelial cells.. American journal of respiratory cell and molecular biology, [PMID:15961727]
8. Petroff, Margaret G MG, Kharatyan, Elza E, Torry, Donald S DS and Holets, Lesya L.. (2005) The immunomodulatory proteins B7-DC, B7-H2, and B7-H3 are differentially expressed across gestation in the human placenta.. The American journal of pathology, [PMID:16049332]
9. Zhang, Guangbo G, Dong, Qiuming Q, Xu, Ying Y, Yu, Gehua G and Zhang, Xueguang X.. (2005) B7-H3: another molecule marker for Mo-DCs?. Cellular & molecular immunology, [PMID:16274630]
10. Otsuki, Tetsuji T and 24 more authors.. (2005) Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.. DNA research : an international journal for rapid publication of reports on genes and genomes, [PMID:16303743]
11. Hashiguchi, Masaaki M and 5 more authors.. (2008) Triggering receptor expressed on myeloid cell-like transcript 2 (TLT-2) is a counter-receptor for B7-H3 and enhances T cell responses.. Proceedings of the National Academy of Sciences of the United States of America, (29): [PMID:18650384]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.