| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp143119-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $59.90 | |
| rp143119-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp143119-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $249.90 | |
| rp143119-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,959.90 |
Animal Free, ≥90% (SDS-PAGE), Active, 293F, C-His tag, 22-460 aa
| Product Name | Recombinant human BACE1 protein, ≥90% (SDS-PAGE), high purity |
|---|---|
| Synonyms | APP beta-secretase; ASP2; Aspartyl protease 2; BACE1; BACE-1; BACEAsp 2; beta-secretase 1 precursor variant 1; beta-secretase 1; beta-site amyloid beta A4 precursor protein-cleaving enzyme; Beta-site amyloid precursor protein cleaving enzyme 1; Beta-site |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description |
Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥90%(SDS-PAGE) |
| Purity | ≥90% (SDS-PAGE) |
| Bioactivity | Measured by its ability to cleave a fluorogenic peptide substrate, Mca-SEVNLDAEFRK(Dpn)RR-NH2. The specific activity is >5.5 pmol/min/μg. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 22-460 aa |
| Sequence | TQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTYRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDSLEPFFDSLVKQTHVPNLFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKM |
| Protein Tag | C-His |
| Accession # | P56817 |
| Predicted molecular weight | 49 kDa |
| SDS-PAGE | 60-70 kDa |
Recombinant Human BACE1 Protein (rp143119) - SDS-PAGE
3 μg/lane of Recombinant Human BACE1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 60.0 - 70.0 kDa under reducing conditions and 55.0 - 60.0 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0505374 | Certificate of Analysis | May 15, 2024 | rp143119 |
| ZJ24F0505373 | Certificate of Analysis | May 15, 2024 | rp143119 |
| ZJ24F0505372 | Certificate of Analysis | May 15, 2024 | rp143119 |
