Recombinant Human BCMA/TNFRSF17 Protein

Item Number

rp169554

• Product Name: Recombinant Human BCMA/TNFRSF17 Protein
• Grade: ActiBioPure™, Animal Free, Bioactive, Carrier Free
• Specifications & Purity: ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥90%(SDS-PAGE)
• Bioactivity: Immobilized Recombinant Human BCMA/TNFRSF17 Protein (rp169554) at 0.5 μg/mL can bind Belantamab (anti-TNFRSF17) (Ab170526) with the EC50 of 22.0 ng/mL.
• Endotoxin Concentration: <1 EU/μg
• Expression System: HEK293
• Amino Acids: 1-54 aa
• Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT
• Protein Tag: C-Fc
• Predicted molecular weight: 34.3 kDa
• SDS-PAGE: 34.0-44.3 kDa, under reducing conditions; 57.0-90.2 kDa, under non-reducing conditions

Product Description

Protein Function:
BCMA, B cell maturation antigen, is a member of the TNF receptor superfamily. It has been designated TNFRSF17. BCMA is a type III membrane protein containing one extracellular cysteine rich domain. Within the TNFRSF, it shares the highest homology with TACI. BCMA and TACI have both been shown to bind to APRIL and BAFF, members of the TNF ligand superfamily. BCMA expression has been found in immune organs and mature B cell lines. Although some expression has been observed at the cell surface, BCMA appears to be localized to the Golgi compartment. The binding of BCMA to APRIL or BAFF has been shown to stimulate IgM production in peripheral blood B cells and increase the survival of cultured B cells. This data suggests that BCMA may play an important role in B cell development, function and regulation. Human BCMA is a 184 amino acid (aa) protein consisting of a 54 aa extracellular domain, a 23 aa transmembrane domain, and a 107 aa intracellular domain. Mouse and human BCMA share 62% amino acid identity.