Recombinant Human Betacellulin GMP Protein

Features and benefits

Expression System: E. coli
Protein Tag: No tag
Bioactivity: Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.100-1.50 ng/mL.
Endotoxin Concentration: <0.1 EU/μg

Item Number

rp165614-GMP

Grouped product items
SKU	Size	Availability	Price	Qty
rp165614-GMP-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$1,049.90
rp165614-GMP-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$8,399.90

GMP, ≥97% (SDS-PAGE&SEC-HPLC), Active, E.coli, No tag, 32-118 aa

View related series

Basic Description

Product Name	Recombinant Human Betacellulin GMP Protein
Grade	ActiBioPure™, Animal Free, Bioactive, Carrier Free, GMP, 高性能
Specifications & Purity	ActiBioPure™, GMP, Carrier Free, Bioactive, High performance, Animal Free, ≥97%(SDS-PAGE&SEC-HPLC)
Biochemical and Physiological Mechanisms	Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.
Bioactivity	Measured in a cell proliferation assay using Balb/3T3 mouse embryonic fibroblast cells. The ED50 for this effect is 0.100-1.50 ng/mL.
Endotoxin Concentration	<0.1 EU/μg
Expression System	E. coli
Amino Acids	32-118 aa
Sequence	MDGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQ
Protein Tag	No tag
N-terminal Sequence	Met-Asp32-Gly-Asn-Ser-Thr-Arg-Ser-Pro-Glu
Predicted molecular weight	9.9 kDa
SDS-PAGE	12-15 kDa, under reducing conditions.

Product Specifications

Reconstitution	Reconstitute at 100-500 μg/mL in PBS.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	A minimum of 12 months when stored at ≤ -20 ℃ as supplied. 1 month, 2 to 8 ℃ under sterile conditions after reconstitution. 3 months, ≤ -20 ℃ under sterile conditions after reconstitution. Upon delivery aliquot. Avoid freeze/thaw cycle.

Solution Calculators

Determine the necessary mass, volume, or concentration for preparing a solution.

Determine the dilution needed to prepare a stock solution.

Basic Description