| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp143300-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $969.90 | |
| rp143300-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,699.90 | |
| rp143300-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,299.90 | |
| rp143300-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $25,999.90 |
Animal Free, >95% (SDS-PAGE&HPLC), Active, E. coli, No tag, 363-472 aa
| Product Name | Recombinant Human BMP3 Protein, >95% (SDS-PAGE&HPLC), high purity |
|---|---|
| Synonyms | BMP3; BMP-3; BMP3A; BMP-3A; Bone morphogenetic protein 3 (osteogenic); Bone morphogenetic protein 3; Bone morphogenetic protein 3A; Bone morphogenetic protein-3; Osteogenin |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE&HPLC) |
| Purity | >95% (SDS-PAGE&HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit BMP-2-induced activity in murine MC3T3‑E1 cells. |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Species | Human |
| Amino Acids | 363-472 aa |
| Sequence | QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR |
| Protein Tag | No tag |
| Accession # | P12645.1 |
| Predicted molecular weight | 24.8 kDa |
| SDS-PAGE | 24.8 kDa |
Recombinant Human BMP3 Protein (rp143300) - SDS-PAGE
Recombinant Human BMP3 Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a band at 24.8 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4 mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Fur |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconstitution. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0505680 | Certificate of Analysis | May 24, 2024 | rp143300 |
| ZJ24F0505681 | Certificate of Analysis | May 24, 2024 | rp143300 |
| ZJ24F0505682 | Certificate of Analysis | May 24, 2024 | rp143300 |
| 1. Wozney, J M JM and 7 more authors.. (1988) Novel regulators of bone formation: molecular clones and activities.. Science (New York, N.Y.), (16): [PMID:3201241] |
| 2. Daluiski, A A and 8 more authors.. (2001) Bone morphogenetic protein-3 is a negative regulator of bone density.. Nature genetics, [PMID:11138004] |
| 3. Kloen, P P and 6 more authors.. (2003) BMP signaling components are expressed in human fracture callus.. Bone, [PMID:13678778] |
| 4. Kang, Q Q and 14 more authors.. (2004) Characterization of the distinct orthotopic bone-forming activity of 14 BMPs using recombinant adenovirus-mediated gene delivery.. Gene therapy, [PMID:15269709] |
| 5. Chen, Andrew L AL and 5 more authors.. (2004) Expression of bone morphogenetic proteins, receptors, and tissue inhibitors in human fetal, adult, and osteoarthritic articular cartilage.. Journal of orthopaedic research : official publication of the Orthopaedic Research Society, [PMID:15475196] |
| 6. Hillier, Ladeana W LW and 121 more authors.. (2005) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.. Nature, (7): [PMID:15815621] |
| 7. Allendorph, George P GP, Isaacs, Michael J MJ, Kawakami, Yasuhiko Y, Izpisua Belmonte, Juan Carlos JC and Choe, Senyon S.. (2007) BMP-3 and BMP-6 structures illuminate the nature of binding specificity with receptors.. Biochemistry, (30): [PMID:17924656] |
| 8. Bian, Yangyang Y and 9 more authors.. (2014) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.. Journal of proteomics, (16): [PMID:24275569] |
| 9. Wen, Jialing and 9 more authors.. (2019) BMP3 suppresses colon tumorigenesis via ActRIIB/SMAD2-dependent and TAK1/JNK signaling pathways.. Journal of experimental & clinical cancer research : CR, (28): [PMID:31665064] |
