My Cart
You have no items in your shopping cart.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp143576-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $89.90 | |
rp143576-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $249.90 | |
rp143576-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
rp143576-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-10*His tag, 19-290 aa
Product Name | Recombinant Human Carbonic Anhydrase XIV Protein |
---|---|
Synonyms | Carbonate dehydratase XIV | Carbonic anhydrase XIV | CA-XIV | EC 4.2.1.1 | Carbonate dehydratase XIV | Carbonic Anhydrase XIV | carbonic anhydrase XIVcarbonic anhydrase 14 | carbonic dehydratase | CAXiV | CA-XIV | EC 4.2.1.1 | CA14 |
Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free |
Product Description |
Function |
Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥95%(SDS-PAGE) |
Bioactivity | Measured by its esterase activity. The specific activity is >100 pmol/min/µg, as measured under the described conditions. |
Endotoxin Concentration | <0.1 EU/μg |
Expression System | HEK293 |
Species | Human |
Amino Acids | 19-290 aa |
Sequence | GQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEMHHHHHHHHHH |
Protein Tag | C-10His |
Accession # | Q9ULX7 |
Predicted molecular weight | 32 kDa |
SDS-PAGE | 37 - 43 kDa, under reducing conditions; 34 - 41 kDa, under non-reducing conditions. |
Recombinant Human Carbonic Anhydrase XIV Protein (rp143576) - SDS-PAGE
3 μg/lane of Recombinant Human Carbonic Anhydrase XIV Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 37 - 43 kDa under reducing condition and 34 - 41 kDa under non-reducing condition.
Form | Liquid |
---|---|
Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
1. Antonaroli S, Bianco A, Brufani M, Cellai L, Lo Baido G, Potier E, Bonomi L, Perfetti S, Fiaschi AI, Segre G.. (1992) Acetazolamide-like carbonic anhydrase inhibitors with topical ocular hypotensive activity.. J Med Chem, 35 (14): (2697-2703). [PMID:1635066] [10.1021/jm00092a021] |
2. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C et al.. (2003) The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.. Genome Res, 13 (10): (2265-70). [PMID:12975309] [10.1021/op500134e] |
3. Garaj V, Puccetti L, Fasolis G, Winum JY, Montero JL, Scozzafava A, Vullo D, Innocenti A, Supuran CT. (2004) Carbonic anhydrase inhibitors: synthesis and inhibition of cytosolic/tumor-associated carbonic anhydrase isozymes I, II, and IX with sulfonamides incorporating 1,2,4-triazine moieties.. Bioorg Med Chem Lett, 14 (21): (5427-33). [PMID:15454239] [10.1021/op500134e] |
4. Temperini C, Scozzafava A, Vullo D, Supuran CT. (2006) Carbonic anhydrase activators. Activation of isozymes I, II, IV, VA, VII, and XIV with l- and d-histidine and crystallographic analysis of their adducts with isoform II: engineering proton-transfer processes within the active site of an enzyme.. Chemistry, 12 (27): (7057-66). [PMID:16807956] [10.1021/op500134e] |
5. Isao Nishimori,Tomoko Minakuchi,Takuhiro Kohsaki,Saburo Onishi,Hiroaki Takeuchi,Daniela Vullo,Andrea Scozzafava,Claudiu T Supuran. (2007-05-08) Carbonic anhydrase inhibitors: the beta-carbonic anhydrase from Helicobacter pylori is a new target for sulfonamide and sulfamate inhibitors.. Bioorganic & medicinal chemistry letters, 17 ((13)): (3585-3594). [PMID:17482815] |
6. Daniela Vullo,Alessio Innocenti,Isao Nishimori,Andrea Scozzafava,Kai Kaila,Claudiu T Supuran. (2007-06-02) Carbonic anhydrase activators: activation of the human isoforms VII (cytosolic) and XIV (transmembrane) with amino acids and amines.. Bioorganic & medicinal chemistry letters, 17 ((15)): (4107-4112). [PMID:17540561] |
7. T Abdülkadir Coban,Sükrü Beydemir,Ilhami Gülcin,Ilhami Gücin,Deniz Ekinci,Alessio Innocenti,Daniela Vullo,Claudiu T Supuran. (2009-07-29) Sildenafil is a strong activator of mammalian carbonic anhydrase isoforms I-XIV.. Bioorganic & medicinal chemistry, 17 ((16)): (5791-5795). [PMID:19635671] |
8. Temperini C, Innocenti A, Guerri A, Scozzafava A, Rusconi S, Supuran CT.. (2007) Phosph(on)ate as a zinc-binding group in metalloenzyme inhibitors: X-ray crystal structure of the antiviral drug foscarnet complexed to human carbonic anhydrase I.. Bioorg Med Chem Lett, 17 (8): (2210-2215). [PMID:17314045] [10.1016/j.bmcl.2007.01.113] |
9. Thiry A, Rolin S, Vullo D, Frankart A, Scozzafava A, Dogné JM, Wouters J, Supuran CT, Masereel B.. (2008) Indanesulfonamides as carbonic anhydrase inhibitors and anticonvulsant agents: structure-activity relationship and pharmacological evaluation.. Eur J Med Chem, 43 (12): (2853-2860). [PMID:18406497] [10.1016/j.ejmech.2008.02.018] |
10. Gitto R, Ferro S, Agnello S, De Luca L, De Sarro G, Russo E, Vullo D, Supuran CT, Chimirri A.. (2009) Synthesis and evaluation of pharmacological profile of 1-aryl-6,7-dimethoxy-3,4-dihydroisoquinoline-2(1H)-sulfonamides.. Bioorg Med Chem, 17 (10): (3659-3664). [PMID:19398204] [10.1016/j.bmc.2009.03.066] |
11. Parkkila S, Innocenti A, Kallio H, Hilvo M, Scozzafava A, Supuran CT.. (2009) The protein tyrosine kinase inhibitors imatinib and nilotinib strongly inhibit several mammalian alpha-carbonic anhydrase isoforms.. Bioorg Med Chem Lett, 19 (15): (4102-4106). [PMID:19527930] [10.1016/j.bmcl.2009.06.002] |
12. Gitto R, Agnello S, Ferro S, De Luca L, Vullo D, Brynda J, Mader P, Supuran CT, Chimirri A.. (2010) Identification of 3,4-Dihydroisoquinoline-2(1H)-sulfonamides as potent carbonic anhydrase inhibitors: synthesis, biological evaluation, and enzyme--ligand X-ray studies.. J Med Chem, 53 (6): (2401-2408). [PMID:20170095] [10.1021/jm9014026] |
13. Pinard MA, Boone CD, Rife BD, Supuran CT, McKenna R.. (2013) Structural study of interaction between brinzolamide and dorzolamide inhibition of human carbonic anhydrases.. Bioorg Med Chem, 21 (22): (7210-7215). [PMID:24090602] [10.1016/j.bmc.2013.08.033] |
14. De Luca L, Ferro S, Damiano FM, Supuran CT, Vullo D, Chimirri A, Gitto R.. (2014) Structure-based screening for the discovery of new carbonic anhydrase VII inhibitors.. Eur J Med Chem, 71 (105-111). [PMID:24287559] [10.1016/j.ejmech.2013.10.071] |
15. Dudutienė V, Matulienė J, Smirnov A, Timm DD, Zubrienė A, Baranauskienė L, Morkūnaite V, Smirnovienė J, Michailovienė V, Juozapaitienė V, Mickevičiūtė A, Kazokaitė J, Bakšytė S, Kasiliauskaitė A, Jachno J, Revuckienė J, Kišonaitė M, Pilipuitytė V, Ivanauskaitė E, Milinavičiūtė G, Smirnovas V, Petrikaitė V, Kairys V, Petrauskas V, Norvaišas P, Lingė D, Gibieža P, Capkauskaitė E, Zakšauskas A, Kazlauskas E, Manakova E, Gražulis S, Ladbury JE, Matulis D.. (2014) Discovery and characterization of novel selective inhibitors of carbonic anhydrase IX.. J Med Chem, 57 (22): (9435-9446). [PMID:25358084] [10.1021/jm501003k] |
16. Akocak S, Alam MR, Shabana AM, Sanku RK, Vullo D, Thompson H, Swenson ER, Supuran CT, Ilies MA.. (2016) PEGylated Bis-Sulfonamide Carbonic Anhydrase Inhibitors Can Efficiently Control the Growth of Several Carbonic Anhydrase IX-Expressing Carcinomas.. J Med Chem, 59 (10): (5077-5088). [PMID:27144971] [10.1021/acs.jmedchem.6b00492] |
17. Mboge MY,Combs J,Singh S,Andring J,Wolff A,Tu C,Zhang Z,McKenna R,Frost SC. (2021) Inhibition of Carbonic Anhydrase Using SLC-149: Support for a Noncatalytic Function of CAIX in Breast Cancer.. J Med Chem, 64 (3.0): (1713-1724). [PMID:33523653] [10.1021/acs.jmedchem.0c02077] |
18. Fujikawa-Adachi, K K, Nishimori, I I, Taguchi, T T and Onishi, S S.. (1999) Human carbonic anhydrase XIV (CA14): cDNA cloning, mRNA expression, and mapping to chromosome 1.. Genomics, (1): [PMID:10512682] |
19. Temperini, Claudia C, Scozzafava, Andrea A, Vullo, Daniela D and Supuran, Claudiu T CT.. (2006) Carbonic anhydrase activators. Activation of isoforms I, II, IV, VA, VII, and XIV with L- and D-phenylalanine and crystallographic analysis of their adducts with isozyme II: stereospecific recognition within the active site of an enzyme and its consequences for the drug design.. Journal of medicinal chemistry, (18): [PMID:16686544] |
20. Gregory, S G SG and 178 more authors.. (2006) The DNA sequence and biological annotation of human chromosome 1.. Nature, (18): [PMID:16710414] |
21. Supuran, Claudiu T CT, Di Fiore, Anna A and De Simone, Giuseppina G.. (2008) Carbonic anhydrase inhibitors as emerging drugs for the treatment of obesity.. Expert opinion on emerging drugs, [PMID:18537527] |
22. Bonneau, Adeline A, Maresca, Alfonso A, Winum, Jean-Yves JY and Supuran, Claudiu T CT.. (2013) Metronidazole-coumarin conjugates and 3-cyano-7-hydroxy-coumarin act as isoform-selective carbonic anhydrase inhibitors.. Journal of enzyme inhibition and medicinal chemistry, [PMID:22299576] |
23. Alterio, Vincenzo V and 6 more authors.. (2014) The structural comparison between membrane-associated human carbonic anhydrases provides insights into drug design of selective inhibitors.. Biopolymers, [PMID:24374484] |