| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp188217-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $89.90 | |
| rp188217-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $269.90 | |
| rp188217-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $429.90 | |
| rp188217-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Carrier Free, ≥90% (SDS-PAGE), E. coli, N-His, 2-527 aa
| Product Name | Recombinant Human Catalase Protein |
|---|---|
| Synonyms | Cas1 | CAT | CATA_HUMAN | Catalase | Cs1 | MGC138422 | MGC138424 |
| Grade | Carrier Free |
| Specifications & Purity | Carrier Free, ≥90%(SDS-PAGE), Lot by Lot |
| Biochemical and Physiological Mechanisms | Catalase is a ubiquitously expressed enzyme that catalyzes the decomposition of hydrogen peroxide to water and oxygen. It is a tetramer of four polypeptides chains containing four porphyrin heme groups that allow the enzyme to react with the hydrogen pero |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 2-527 aa |
| Sequence | MHHHHHHADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNANGEAVYCKFHYKTDQGIKNLSVED |
| Protein Tag | N-His |
| Predicted molecular weight | 60.6 kDa |
| SDS-PAGE | 59.3 kDa, under reducing conditions; 59.3 kDa, under non-reducing conditions. |
Recombinant Human Catalase Protein (rp188217) - SDS-PAGE
2 μg/lane of Recombinant Human Catalase Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 59.3 kDa.
| Concentration | Lot by Lot |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
