| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp170428-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp170428-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
| rp170428-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $599.90 | |
| rp170428-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,999.90 |
Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 24-94 aa
| Product Name | Recombinant Human CCL17/TARC Protein |
|---|---|
| Synonyms | ABCD-2 | CC chemokine TARC | C-C motif chemokine 17 | CCL17 | chemokine (C-C motif) ligand 17 | MGC138273 | SCYA17 | SCYA17MGC138271 | small inducible cytokine subfamily A (Cys-Cys), member 17 | Small-inducible cytokine A17 | T cell-directed CC chemokine |
| Grade | Carrier Free |
| Product Description | Chemokines are a family of small chemotactic cytokines, or proteins secreted by cells. Chemokines share the same structure similarities such as small size, and the presence of four cysteine residues in conserved locations in order to form their 3-dimensional shape. Some of the chemokines are considered pro-inflammatory which can be induced to recruit cells of the immune system to a site of infection during an immune response, while others are considered homeostatic and are implied in controlling the migration of cells during normal processes of tissue maintenance and development. There are four members of the chemokine family: C-C kemokines, C kemokines, CXC kemokines and CX3C kemokines. The C-C kemokines have two cysteines nearby the amino terminus. There have been at least 27 distinct members of this subgroup reported for mammals, called C-C chemokine ligands-1 to 28. Chemokin ligand 17 (CCL17), also known as thymus and activation regulated chemokine(TARC), is a small cytokine belonging to the C-C chemokine family. CCL17 is expressed maily in thymus and transiently in phytohemagglutinin-stimulated peripheral blood mononuclear cells. CCL17 can induce chemotaxis in T cells by binding with the chemokine receptor CCR4. |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE) |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 24-94 aa |
| Sequence | GARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS |
| Protein Tag | No tag |
| Predicted molecular weight | 8.1 kDa |
| SDS-PAGE | 10.4 kDa, under reducing conditions; 11.3 kDa, under non-reducing conditions |
Recombinant Human CCL17/TARC Protein (rp170428) - SDS-PAGE
1 μg/lane of Recombinant Human CCL17/TARC Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.4 kDa under reducing conditions and 11.3 kDa under non-reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0707651 | Certificate of Analysis | Jul 05, 2024 | rp170428 |
| ZJ24F0707650 | Certificate of Analysis | Jul 05, 2024 | rp170428 |
| ZJ24F0707649 | Certificate of Analysis | Jul 05, 2024 | rp170428 |
| ZJ24R0600641 | Certificate of Analysis | Jun 10, 2024 | rp170428 |
