Determine the necessary mass, volume, or concentration for preparing a solution.
Recombinant Human CCL18/PARC Protein (rp179836) - Protein Bioactivity
Determined by its ability to chemoattract Jurkat using a concentration range of 10.0-100.0 ng/mL.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp179836-10μg (Trial Size) Apply for free trial size(?) Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
rp179836-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $379.90 | |
rp179836-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $629.90 | |
rp179836-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Carrier Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 21-89 aa
Product Name | Recombinant Human CCL18/PARC Protein |
---|---|
Grade | ActiBioPure™, Bioactive, Carrier Free, High Performance |
Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, High performance, ≥95%(SDS-PAGE) |
Biochemical and Physiological Mechanisms | Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has che |
Bioactivity | Determined by its ability to chemoattract Jurkat using a concentration range of 10.0-100.0 ng/mL. |
Endotoxin Concentration | <1.0 EU/μg |
Expression System | E. coli |
Amino Acids | 21-89 aa |
Sequence | AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
Protein Tag | No tag |
Predicted molecular weight | 7.9 kDa |
SDS-PAGE | 10.6 kDa, under reducing conditions; 13.2 kDa, under non-reducing conditions. |
Recombinant Human CCL18/PARC Protein (rp179836) - Protein Bioactivity
Determined by its ability to chemoattract Jurkat using a concentration range of 10.0-100.0 ng/mL.
Recombinant Human CCL18/PARC Protein (rp179836) - SDS-PAGE
3 μg/lane of Recombinant Human CCL18/PARC Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.6 kDa under reducing conditions and 13.2 kDa under non-reducing conditions.
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
---|---|
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20°C for 1 year. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA: