| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp181317-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $89.90 | |
| rp181317-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $299.90 | |
| rp181317-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $479.90 | |
| rp181317-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,569.90 |
Carrier Free, ≥95% (SDS-PAGE), E. coli, No tag, 27-119 aa
| Product Name | Recombinant Human CCL24/Eotaxin-2/MPIF-2 Protein |
|---|---|
| Synonyms | chemokine (C-C motif) ligand 24 | CCL24 | Ckb-6 | Eosinophil chemotactic protein 2 | Eotaxin-2 | member 24 | MPIF2 | MPIF-2 | MPIF2Myeloid progenitor inhibitory factor 2 | MPIF-2Small-inducible cytokine A24 | SCYA24CK-beta-6 |
| Grade | Carrier Free |
| Product Description | Protein Function:： |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE) |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 27-119 aa |
| Sequence | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC |
| Protein Tag | No tag |
| Predicted molecular weight | 10.5 kDa |
| SDS-PAGE | 13.0 kDa, under reducing conditions; 25.0 kDa, under non-reducing conditions |
Recombinant Human CCL24/Eotaxin-2/MPIF-2 Protein (rp181317) - SDS-PAGE
1 μg/lane of Recombinant Human CCL24/Eotaxin-2/MPIF-2 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 13.0 kDa under reducing conditions and 25.0 kDa under non-reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24R0800862 | Certificate of Analysis | Aug 02, 2024 | rp181317 |
