| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp169573-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $59.90 | |
| rp169573-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp169573-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $219.90 | |
| rp169573-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,099.90 |
Animal Free, ≥90% (SDS-PAGE), Active, 293F cell, C-His tag, 1-352 aa
| Product Name | Recombinant Human CD14 Protein |
|---|---|
| Synonyms | CD14 molecule | CD14 antigen | CD14 | CD14_HUMAN | LPS-R | Mo2 | monocyte differentiation antigen CD14 | Myeloid cell-specific leucine-rich glycoprotein | Myeloid cell specific leucine rich glycoprotein | Monocyte differentiation antigen CD14 urinary form |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free |
| Product Description |
The cluster of differentiation (CD) system is commonly used as cell markers in immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. Cluster of differentiation 14 (CD14) is a member of the CD system. It takes its name from its inclusion in the CD molecule surface marker proteins. CD14 exists in two forms: a form anchored into the membrane or a soluble form. CD14 was found expressed in macrophages, neutrophil granulocyte and dendritic cells. The major function is to serve as a co-receptor (along with TLR4 and MD-2) for the bacterial lipopolysaccharide (LPS) and other pathogen-associated molecular patterns.
|
| Specifications & Purity | ActiBioPure™, Animal Free, Carrier Free, Bioactive, ≥90%(SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human CD14 Protein (rp169573) at 1.0 μg/mL can bind Recombinant CD14 Antibody (Ab006698) with the EC50 of 5.7 ng/mL. |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 1-352 aa |
| Sequence | MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLD |
| Protein Tag | C-His |
| Predicted molecular weight | 38.1 kDa |
| SDS-PAGE | 39.2-53.0 kDa, under reducing conditions; 37.4-51.2 kDa, under non-reducing conditions |
Recombinant Human CD14 Protein (rp169573) - ELISA
Immobilized Recombinant Human CD14 Protein (rp169573) at 1.0 μg/mL can bind Recombinant CD14 Antibody (Ab006698) with the EC
₅
₀
of 5.7 ng/mL.
Recombinant Human CD14 Protein (rp169573) - SDS-PAGE
3 μg/lane of Recombinant Human CD14 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 39.2-53.0 kDa under reducing conditions and 37.4-51.2 kDa under non-reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24R0800864 | Certificate of Analysis | Aug 02, 2024 | rp169573 |
