Recombinant Human CD276 Protein, ＞95% (SDS-PAGE), high purity

Item Number

rp143912

• Product Name: Recombinant Human CD276 Protein, ＞95% (SDS-PAGE), high purity
• Synonyms: B7H3; B7-H3; B7H34Ig-B7-H3; B7-H3B7 homolog 3; CD276 antigen; CD276 molecule; CD276; Costimulatory molecule; B7RP-2; 4Ig-B7-H3
• Grade: ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
• Specifications & Purity: ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
• Purity: ＞95% (SDS-PAGE)
• Bioactivity: 1、Immobilized Recombinant Human CD276 Protein (rp143912) at 0.5 μg/mL can bind Anti Human CD276 Antibody with the EC50 of 10.73 ng/mL. 2、Immobilized Recombinant Human CD276 Protein (rp143912) at 1 μg/mL can bind Anti Human CD276 Antibody with a linear ran
• Endotoxin Concentration: ＜0.1 EU/μg
• Expression System: HEK293
• Species: Human
• Amino Acids: 29-246 aa
• Sequence: LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPHHHHHH
• Protein Tag: C-His
• Accession #: Q5ZPR3-2
• Predicted molecular weight: 23 kDa
• SDS-PAGE: 38.9 kDa, under reducing conditions; 37.0 kDa, under non-reducing conditions.

Product Description

Purity
>95% SDS-PAGE

Function
May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in the development of acute and chronic transplant rejection and in the regulation of lymphocytic activity at mucosal surfaces. Could also play a key role in providing the placenta and fetus with a suitable immunological environment throughout pregnancy. Both isoform 1 and isoform 2 appear to be redundant in their ability to modulate CD4 T-cell responses. Isoform 2 is shown to enhance the induction of cytotoxic T-cells and selectively stimulates interferon gamma production in the presence of T-cell receptor signaling.