| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp169577-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp169577-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $299.90 | |
| rp169577-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $439.90 | |
| rp169577-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,999.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 1-379 aa
| Product Name | Recombinant Human CD30/TNFRSF8 Protein |
|---|---|
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free |
| Product Description | Protein Function:： |
| Specifications & Purity | Animal Free, Carrier Free, Bioactive, ActiBioPure™, ≥95%(SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human CD30 Protein (rp169577) at 1.0 μg/mL can bind Brentuximab (anti-TNFRSF8) (Ab170548) with the EC50 of 119.9 ng/mL. |
| Endotoxin Concentration | <1 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 1-379 aa |
| Sequence | MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGR |
| Protein Tag | C-His |
| Predicted molecular weight | 39.2 kDa |
| SDS-PAGE | 55.0-99.0 kDa, under reducing conditions |
Recombinant Human CD30/TNFRSF8 Protein (rp169577) - ELISA
Immobilized Recombinant Human CD30/TNFRSF8 Protein (rp169577) at 1.0 μg/mL can bind Brentuximab (anti-TNFRSF8) (Ab170548) with the EC₅₀ of 119.9 ng/mL.
Recombinant Human CD30/TNFRSF8 Protein (rp169577) - SDS-PAGE
3 μg/lane of Recombinant Human CD30/TNFRSF8 Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a band at 55.0-99.0 kDa under reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0708053 | Certificate of Analysis | Jul 12, 2024 | rp169577 |
| ZJ24F0708052 | Certificate of Analysis | Jul 12, 2024 | rp169577 |
| ZJ24F0708051 | Certificate of Analysis | Jul 12, 2024 | rp169577 |
| ZJ24F0708050 | Certificate of Analysis | Jul 12, 2024 | rp169577 |
