| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp143954-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $79.90 | |
| rp143954-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $199.90 | |
| rp143954-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $369.90 | |
| rp143954-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,539.90 |
Animal Free, >95%(SDS-PAGE), Active, 293F, His tag, 28-601 aa
| Product Name | Recombinant Human CD31/PECAM-1 Protein, ＞95%(SDS-PAGE), high purity |
|---|---|
| Synonyms | adhesion molecule; CD31 antigen; CD31; CD31/EndoCAM; EndoCAM; FLJ34100; FLJ58394; GPIIA'; PECA1; PECAM1; PECAM-1; PECAM-1, CD31/EndoCAM; platelet endothelial cell adhesion molecule; platelet endothelial cell adhesion molecule-1; platelet/endothelial cell |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity >95% SDS-PAGE. Function Induces susceptibility to atherosclerosis (By similarity). Cell adhesion molecule which is required for leukocyte transendothelial migration (TEM) under most inflammatory conditions. Tyr-690 plays a critical role in TEM and is required for efficient trafficking of PECAM1 to and from the lateral border recycling compartment (LBRC) and is also essential for the LBRC membrane to be targeted around migrating leukocytes. Prevents phagocyte ingestion of closely apposed viable cells by transmitting 'detachment' signals, and changes function on apoptosis, promoting tethering of dying cells to phagocytes (the encounter of a viable cell with a phagocyte via the homophilic interaction of PECAM1 on both cell surfaces leads to the viable cell's active repulsion from the phagocyte. During apoptosis, the inside-out signaling of PECAM1 is somehow disabled so that the apoptotic cell does not actively reject the phagocyte anymore. The lack of this repulsion signal together with the interaction of the eat-me signals and their respective receptors causes the attachment of the apoptotic cell to the phagocyte, thus triggering the process of engulfment). Isoform Delta15 is unable to protect against apoptosis. Modulates BDKRB2 activation. Regulates bradykinin- and hyperosmotic shock-induced ERK1/2 activation in human umbilical cord vein cells (HUVEC). Post-translational Phosphorylated on Ser and Tyr residues after cellular activation. In endothelial cells Fyn mediates mechanical-force (stretch or pull) induced tyrosine phosphorylation. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ＞95%(SDS-PAGE) |
| Bioactivity | 1. Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells in the presence of 10 μg/mL PHA. The ED₅₀ value was lower than 5 ng/mL. 2. Measured by the ability of the immobilized protein to sup |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 28-601 aa |
| Sequence | QENSFTINSVDMKSLPDWTVQNGKNLTLQCFADVSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTTAEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKREKNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHISPTGMIMEGAQLHIKCTIQVTHLAQEFPEIIIQKDKAIVAHN |
| Protein Tag | C-His |
| Accession # | P16284 |
| Predicted molecular weight | 64 kDa |
| SDS-PAGE | 94.5 kDa, under reducing conditions; 85.9 kDa, under non-reducing conditions. |
Recombinant Human CD31/PECAM-1 Protein (rp143954) - Protein Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells in the presence of 10 μg/mL PHA. The ED₅₀ value was lower than 5 ng/mL.
Recombinant Human CD31/PECAM-1 Protein (rp143954) - Protein Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of Jurkat human acute T cell leukemia cells. When 8×104 cells/well are added to CD31 coated plates (5μg/mL, 100 μL/well) in the presence of 10 μg/mL PHA, approximately 60-70% will adhere after 30 minutes at 37℃.
Recombinant Human CD31/PECAM-1 Protein (rp143954) - SDS-PAGE
3μg/lane of Recombinant Human CD31/PECAM-1 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 94.5 kDa under reducing conditions and 85.9 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in water to a concentration of 0.1-1.0 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600496 | Certificate of Analysis | Jul 03, 2023 | rp143954 |
| ZJ23F0600495 | Certificate of Analysis | Jul 03, 2023 | rp143954 |
| ZJ23F0600494 | Certificate of Analysis | Jul 03, 2023 | rp143954 |
