| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp143966-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $69.90 | |
| rp143966-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $299.90 | |
| rp143966-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $499.90 | |
| rp143966-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, >95%(SDS-PAGE), Active, 293F , Fc&His tag, 18-267 aa
| Product Name | Recombinant Human CD33 Protein, ＞95%(SDS-PAGE), high purity |
|---|---|
| Synonyms | CD33 antigen (gp67); CD33 antigen; CD33 molecule; CD33; FLJ00391; gp67; myeloid cell surface antigen CD33; p67; sialic acid binding Ig-like lectin 3; Sialic acid-binding Ig-like lectin 3; Siglec3; Siglec-3; SIGLEC3gp67 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, 高性能 |
| Product Description | Purity >95% SDS-PAGE Additional sequence information Fc, 6His tag at the C-terminus. Function Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro). Post-translational Phosphorylation of Tyr-340 is involved in binding to PTPN6 and PTPN11. Phosphorylation of Tyr-358 is involved in binding to PTPN6. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ＞95%(SDS-PAGE) |
| Bioactivity | 1、Measured by the ability of the immobilized protein to support the adhesion of human red blood cells. The ED50 for this effect is 1‑4 µg/mL. 2、Immobilized Recombinant Human CD33 Protein (rp143966) at 2.0 μg/mL can bind Gemtuzumab (anti-CD33) (A |
| Endotoxin Concentration | <0.10 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 18-267 aa |
| Sequence | DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHENLYFQGMDPKSC |
| Protein Tag | C-Fc & His |
| Accession # | P20138 |
| Predicted molecular weight | 54 kDa |
| SDS-PAGE | 71.0 kDa, under reducing conditions ; 150.7 kDa, under non-reducing conditions. |
Recombinant Human CD33 Protein (rp143966) - Protein Bioactivity
Immobilized Recombinant Human CD33 Protein (rp143966) at 2.0 μg/mL can bind CD33 Mouse mAb (Ab006571). The ED₅₀ for this effect is 251.9 ng/mL.
Recombinant Human CD33 Protein (rp143966) - Protein Bioactivity
Immobilized Recombinant Human CD33 Protein (rp143966) at 2.0 μg/mL can bind Gemtuzumab (anti-CD33) (Ab175859). The ED₅₀ for this effect is 391.3 ng/mL.
Recombinant Human CD33 Protein (rp143966) - SDS-PAGE
3 μg/lane of Recombinant Human CD33 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 71.0 kDa under reducing conditions and 150.7 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0505377 | Certificate of Analysis | May 15, 2024 | rp143966 |
| ZJ24F0505376 | Certificate of Analysis | May 15, 2024 | rp143966 |
| ZJ24F0505375 | Certificate of Analysis | May 15, 2024 | rp143966 |
