| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp156652-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | In stock | $139.90 | |
| rp156652-50μg | 50μg | In stock | $309.90 | |
| rp156652-100μg | 100μg | In stock | $499.90 | |
| rp156652-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,999.90 |
Animal Free, >95% (SDS-PAGE), Active, 293F cell, C-His tag, 1-290 aa
| Product Name | Recombinant Human CD34 Protein, >95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | CD34 | CD34 antigen | CD34 molecule | CD34_HUMAN | Cluster designation 34 | cluster of differentiation 34 | Hematopoietic progenitor cell antigen CD34 | HPCA1 | Mucosialin | OTTHUMP00000034733 | OTTHUMP00000034734 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | >95% (SDS-PAGE) |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized human CD34 (rp156652) at 2.0 μg/mL can bind Mouse CD34 mAb (Ab094638) with the EC₅₀ of 31.41 ng/mL. |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 1-290 aa |
| Sequence | MLVRRGARAGPRMPRGWTALCLLSLLPSGFMSLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISS |
| Protein Tag | C-His |
| Predicted molecular weight | 27.5 kDa |
| SDS-PAGE | 96.5-131.2 kDa, under reducing conditions; 96.5-131.2 kDa, under non-reducing condition |
Recombinant Human CD34 Protein (rp156652) - SDS-PAGE
3 μg/lane of Recombinant Human CD34 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 96.5-131.2 kDa.
Recombinant Human CD34 Protein (rp156652) - ELISA
Measured by its binding ability in a functional ELISA. Immobilized human CD34 (rp156652) at 2.0 μg/mL can bind Mouse CD34 mAb (Ab094638) with the EC₅₀ of 31.41 ng/mL.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C stable up to 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0303253 | Certificate of Analysis | Mar 18, 2024 | rp156652 |
| ZJ24F0303254 | Certificate of Analysis | Mar 18, 2024 | rp156652 |
| ZJ24F0303255 | Certificate of Analysis | Mar 18, 2024 | rp156652 |
| ZJ24R0300325 | Certificate of Analysis | Mar 08, 2024 | rp156652 |
