| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp144028-10μg | 10μg | In stock | $599.90 | |
| rp144028-50μg | 50μg | In stock | $1,549.90 | |
| rp144028-100μg | 100μg | In stock | $2,479.90 | |
| rp144028-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $15,999.90 |
Animal Free, >95% (SDS-PAGE), Active, HEK293, C-Fc tag, 19-139 aa
| Product Name | Recombinant Human CD47 Protein, >95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | antigen identified by monoclonal 1D8 | Antigenic surface determinant protein OA3 | CD47 antigen (Rh-related antigen, integrin-associated signal transducer) | CD47 antigen | CD47 glycoprotein | CD47 molecule | CD47 | IAP | IAPintegrin associated protein | |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | >95% (SDS-PAGE) |
| Bioactivity | 1. Measured by its binding ability in a functional ELISA. Immobilized human B7-H7/HHLA2 Protein at 10 μg/mL can bind Recombinant Human CD47 Protein (rp144028), the EC50 of human CD47 Protein is 50.0 - 200.0 ng/mL. 2. Measured by its binding ability in a f |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 19-139 aa |
| Sequence | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPALEVLFQGPEPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Protein Tag | C-Fc |
| Accession # | Q08722 |
| Predicted molecular weight | 40.7 kDa |
| SDS-PAGE | 59.3 kDa, under reducing conditions; 109.3 kDa, under non-reducing conditions. |
Recombinant Human CD47 Protein (rp144028) - Protein Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized human B7-H7/HHLA2 Protein at 10 μg/mL can bind Recombinant Human CD47 Protein (rp144028), the EC₅₀ of human CD47 Protein is 50.0 - 200.0 ng/mL.
Recombinant Human CD47 Protein (rp144028) - ELISA
Measured by its binding ability in a functional ELISA. Immobilized Recombinant Human CD47 Protein (rp144028) at 1 μg/mL can bind Magrolimab (anti-CD47) (Ab169323) with the EC₅₀ of 10.34 ng/mL.
Recombinant Human CD47 Protein (rp144028) - SDS-PAGE
3 μg/lane of Recombinant Human CD47 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 59.3 kDa under reducing conditions and 109.3 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25mg/mL. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Samples are stable for twelve months from date of receipt at -20℃ to -80℃. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1101861 | Certificate of Analysis | Dec 01, 2023 | rp144028 |
| ZJ23F1101860 | Certificate of Analysis | Dec 01, 2023 | rp144028 |
| ZJ23F1101859 | Certificate of Analysis | Dec 01, 2023 | rp144028 |
| 1. Kauder SE, Kuo TC, Harrabi O, Chen A, Sangalang E, Doyle L, Rocha SS, Bollini S, Han B, Sim J et al.. (2018) ALX148 blocks CD47 and enhances innate and adaptive antitumor immunity with a favorable safety profile.. PLoS One, 13 (8): (e0201832). [PMID:30133535] [10.1021/op500134e] |
| 2. Petrova PS, Viller NN, Wong M, Pang X, Lin GH, Dodge K, Chai V, Chen H, Lee V, House V et al.. (2017) TTI-621 (SIRPαFc): A CD47-Blocking Innate Immune Checkpoint Inhibitor with Broad Antitumor Activity and Minimal Erythrocyte Binding.. Clin Cancer Res, 23 (4): (1068-1079). [PMID:27856600] [10.1021/op500134e] |
| 3. Campbell, I G IG, Freemont, P S PS, Foulkes, W W and Trowsdale, J J.. (1992) An ovarian tumor marker with homology to vaccinia virus contains an IgV-like region and multiple transmembrane domains.. Cancer research, (1): [PMID:1394148] |
| 4. Lindberg, F P FP, Gresham, H D HD, Schwarz, E E and Brown, E J EJ.. (1993) Molecular cloning of integrin-associated protein: an immunoglobulin family member with multiple membrane-spanning domains implicated in alpha v beta 3-dependent ligand binding.. The Journal of cell biology, [PMID:7691831] |
| 5. Mawby, W J WJ, Holmes, C H CH, Anstee, D J DJ, Spring, F A FA and Tanner, M J MJ.. (1994) Isolation and characterization of CD47 glycoprotein: a multispanning membrane protein which is the same as integrin-associated protein (IAP) and the ovarian tumour marker OA3.. The Biochemical journal, (1): [PMID:7998989] |
| 6. Gao, A G AG and 5 more authors.. (1996) Integrin-associated protein is a receptor for the C-terminal domain of thrombospondin.. The Journal of biological chemistry, (5): [PMID:8550562] |
| 7. Wu, A L AL, Wang, J J, Zheleznyak, A A and Brown, E J EJ.. (1999) Ubiquitin-related proteins regulate interaction of vimentin intermediate filaments with the plasma membrane.. Molecular cell, [PMID:10549293] |
| 8. Rebres, R A RA, Vaz, L E LE, Green, J M JM and Brown, E J EJ.. (2001) Normal ligand binding and signaling by CD47 (integrin-associated protein) requires a long range disulfide bond between the extracellular and membrane-spanning domains.. The Journal of biological chemistry, (14): [PMID:11454874] |
| 9. Latour, S S and 11 more authors.. (2001) Bidirectional negative regulation of human T and dendritic cells by CD47 and its cognate receptor signal-regulator protein-alpha: down-regulation of IL-12 responsiveness and inhibition of dendritic cell activation.. Journal of immunology (Baltimore, Md. : 1950), (1): [PMID:11509594] |
| 10. Piccio, Laura L and 7 more authors.. (2005) Adhesion of human T cells to antigen-presenting cells through SIRPbeta2-CD47 interaction costimulates T-cell proliferation.. Blood, (15): [PMID:15383453] |
| 11. Manna, Partha P PP, Dimitry, Julie J, Oldenborg, Per-Arne PA and Frazier, William A WA.. (2005) CD47 augments Fas/CD95-mediated apoptosis.. The Journal of biological chemistry, (19): [PMID:15917238] |
| 12. Hatherley, Deborah D and 5 more authors.. (2008) Paired receptor specificity explained by structures of signal regulatory proteins alone and complexed with CD47.. Molecular cell, (25): [PMID:18657508] |
| 13. Wollscheid, Bernd B and 7 more authors.. (2009) Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.. Nature biotechnology, [PMID:19349973] |
| 14. De Oliveira, S S, Vitorino de Almeida, V V, Calado, A A, Rosário, H S HS and Saldanha, C C.. (2012) Integrin-associated protein (CD47) is a putative mediator for soluble fibrinogen interaction with human red blood cells membrane.. Biochimica et biophysica acta, [PMID:22079249] |
| 15. Rogers, Natasha M NM and 24 more authors.. (2017) TSP1-CD47 signaling is upregulated in clinical pulmonary hypertension and contributes to pulmonary arterial vasculopathy and dysfunction.. Cardiovascular research, [PMID:27742621] |
| 16. Ghimire, Kedar and 11 more authors.. (2020) CD47 Promotes Age-Associated Deterioration in Angiogenesis, Blood Flow and Glucose Homeostasis.. Cells, (15): [PMID:32679764] |
