| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp144040-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp144040-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $379.90 | |
| rp144040-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $619.90 | |
| rp144040-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,699.90 |
Animal Free, ≥95% (SDS-PAGE), Active, HEK293, C-His tag, 27-220 aa
| Product Name | Recombinant human CD48 protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | BCM1 surface antigen; BCM1; BCM1Leukocyte antigen MEM-102; BLAST; BLAST1; BLAST1TCT.1; B-lymphocyte activation marker BLAST-1; CD48 antigen (B-cell membrane protein); CD48 antigen; CD48 molecule; CD48; hCD48; mCD48; MEM-102; SLAMF2; Antigen CD48; B cell m |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Measured by its ability to bind recombinant human CD244. Immobilized recombinant human CD48 at 5 μg/mL (100 μL/well) can bind recombinant human CD244 with a linear range of 0.2-1 μg/mL. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 27-220 aa |
| Sequence | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSHHHHHH |
| Protein Tag | C-His |
| Accession # | P09326 |
| Predicted molecular weight | 22 kDa |
| SDS-PAGE | 35-42 kDa, under reducing conditions |
Recombinant Human CD48 Protein (rp144040) - Protein Bioactivity
Immobilized Recombinant Human CD48 Protein (rp144040) at 5.0 μg/mL can bind recombinant human CD244 with a linear range of 0.2 -1.0 μg/mL.
Recombinant Human CD48 Protein (rp144040) - SDS-PAGE
3 μg/lane of Recombinant Human CD46 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 37.0 - 46.0 kDa.
| Form | lyophilized powder |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0404957 | Certificate of Analysis | Apr 30, 2024 | rp144040 |
| ZJ24F0404956 | Certificate of Analysis | Apr 30, 2024 | rp144040 |
| ZJ24F0404955 | Certificate of Analysis | Apr 30, 2024 | rp144040 |
