| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp166567-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $99.90 | |
| rp166567-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $299.90 | |
| rp166567-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $479.90 | |
| rp166567-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,569.90 |
Animal Free, ≥95% (SDS-PAGE), Active, HEK293, C-His tag, 25-371 aa
| Product Name | Recombinant Human CD5 Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | CD 5; CD5; CD5 antigen; CD5 antigen (p56 62); CD5 molecule; CD5_HUMAN; LEU1; LyA; Lymphocyte antigen T1/Leu-1; OTTHUMP00000236973; T-cell surface glycoprotein CD5; T1 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity dotoxin level |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Recombinant Human CD5 can bind CD5 Antibody with a linear range of 0.800‑8.00 ng/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 25-371 aa |
| Sequence | RLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLV |
| Protein Tag | C-His |
| Predicted molecular weight | 39 kDa |
| SDS-PAGE | 50 kDa, under reducing conditions |
Recombinant Human CD5 Protein (rp166567) - Protein Bioactivity
Recombinant Human CD5 Protein (rp166567) can bind CD5 Antibody with a linear range of 0.80 ‑ 8.0 ng/mL. The EC
₅₀
for this effect is 9.09 ng/mL.
Recombinant Human CD5 Protein (rp166567) - SDS-PAGE
3 μg/lane of Recombinant Human CD5 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 50.0 kDa under reducing conditions and 48.0 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0404852 | Certificate of Analysis | Apr 26, 2024 | rp166567 |
| ZJ24F0404851 | Certificate of Analysis | Apr 26, 2024 | rp166567 |
| ZJ24F0404850 | Certificate of Analysis | Apr 26, 2024 | rp166567 |
| 1. Van de Velde, H H, von Hoegen, I I, Luo, W W, Parnes, J R JR and Thielemans, K K.. (1991) The B-cell surface protein CD72/Lyb-2 is the ligand for CD5.. Nature, (20): [PMID:1711157] |
| 2. Jones, N H NH and 5 more authors.. (1986) Isolation of complementary DNA clones encoding the human lymphocyte glycoprotein T1/Leu-1.. Nature, [PMID:3093892] |
| 3. Salomon, Arthur R AR and 10 more authors.. (2003) Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.. Proceedings of the National Academy of Sciences of the United States of America, (21): [PMID:12522270] |
| 4. Brill, Laurence M LM and 5 more authors.. (2004) Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.. Analytical chemistry, (15): [PMID:15144186] |
| 5. Garza-Garcia, Acely A and 6 more authors.. (2008) Three-dimensional solution structure and conformational plasticity of the N-terminal scavenger receptor cysteine-rich domain of human CD5.. Journal of molecular biology, (18): [PMID:18339402] |
