Skip to the beginning of the images gallery

Recombinant Human CD59 Protein, ≥95% (SDS-PAGE), high purity

≥95%(SDS-PAGE)

Features and benefits

Expression System: HEK293
Accession #: P13987
Protein Tag: C-10His
Bioactivity: When recombinant human C9 is coated at 5 μg/mL (100 μL/well), the concentration of Recombinant Human CD59 that produces 50% optimal binding response is 0.6‑3 μg/mL.
Endotoxin Concentration: ＜0.1 EU/μg

Item Number

rp144061

Grouped product items
SKU	Size	Availability	Price
rp144061-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$139.90
rp144061-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$269.90
rp144061-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$439.90
rp144061-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,199.90

Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-10*His tag, 26-102 aa

View related series

Accession#: P13987 CD59 Gene ID: 966

Basic Description

Product Name	Recombinant Human CD59 Protein, ≥95% (SDS-PAGE), high purity
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description	Purity ≥95% (SDS-PAGE) Endotoxin level <0.1 EU/μg Function Potent inhibitor of the complement membrane attack complex (MAC) action. Acts by binding to the C8 and/or C9 complements of the assembling MAC, thereby preventing incorporation of the multiple copies of C9 required for complete formation of the osmolytic pore. This inhibitor appears to be species-specific. Involved in signal transduction for T-cell activation complexed to a protein tyrosine kinase. The soluble form from urine retains its specific complement binding activity, but exhibits greatly reduced ability to inhibit MAC assembly on cell membranes.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	≥95% (SDS-PAGE)
Bioactivity	When recombinant human C9 is coated at 5 μg/mL (100 μL/well), the concentration of Recombinant Human CD59 that produces 50% optimal binding response is 0.6‑3 μg/mL.
Endotoxin Concentration	＜0.1 EU/μg
Expression System	HEK293
Species	Human
Amino Acids	26-102 aa
Sequence	LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENHHHHHHHHHH
Protein Tag	C-10His
Accession #	P13987
Predicted molecular weight	10 kDa
SDS-PAGE	11.5 & 15.2 kDa, under reducing conditions; 11.5 & 15.2 kDa, under non-reducing conditions.

Product Specifications

Form	Lyophilized
Reconstitution	Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.

References

1. Todd D Taylor,Hideki Noguchi,Yasushi Totoki,Atsushi Toyoda,Yoko Kuroki,Ken Dewar,Christine Lloyd,Takehiko Itoh,Tadayuki Takeda,Dae-Won Kim,Xinwei She,Karen F Barlow,Toby Bloom,Elspeth Bruford,Jean L Chang,Christina A Cuomo,Evan Eichler,Michael G FitzGerald,David B Jaffe,Kurt LaButti,Robert Nicol,Hong-Seog Park,Christopher Seaman,Carrie Sougnez,Xiaoping Yang,Andrew R Zimmer,Michael C Zody,Bruce W Birren,Chad Nusbaum,Asao Fujiyama,Masahira Hattori,Jane Rogers,Eric S Lander,Yoshiyuki Sakaki. (2006-03-24) Human chromosome 11 DNA sequence and analysis including novel gene identification.. Nature, 440 ((7083)): (497-500). [PMID:16554811]
2. Ninomiya, H H and Sims, P J PJ.. (1992) The human complement regulatory protein CD59 binds to the alpha-chain of C8 and to the "b"domain of C9.. The Journal of biological chemistry, (5): [PMID:1377690]
3. Petranka, J G JG, Fleenor, D E DE, Sykes, K K, Kaufman, R E RE and Rosse, W F WF.. (1992) Structure of the CD59-encoding gene: further evidence of a relationship to murine lymphocyte antigen Ly-6 protein.. Proceedings of the National Academy of Sciences of the United States of America, (1): [PMID:1381503]
4. Motoyama, N N, Okada, N N, Yamashina, M M and Okada, H H.. (1992) Paroxysmal nocturnal hemoglobinuria due to hereditary nucleotide deletion in the HRF20 (CD59) gene.. European journal of immunology, [PMID:1382994]
5. Tone, M M, Walsh, L A LA and Waldmann, H H.. (1992) Gene structure of human CD59 and demonstration that discrete mRNAs are generated by alternative polyadenylation.. Journal of molecular biology, (5): [PMID:1383553]
6. Philbrick, W M WM and 5 more authors.. (1990) The CD59 antigen is a structural homologue of murine Ly-6 antigens but lacks interferon inducibility.. European journal of immunology, [PMID:1689664]
7. Sawada, R R and 6 more authors.. (1990) Isolation and expression of the full-length cDNA encoding CD59 antigen of human lymphocytes.. DNA and cell biology, [PMID:1692709]
8. Okada, H H and 6 more authors.. (1989) 20 KDa homologous restriction factor of complement resembles T cell activating protein.. Biochemical and biophysical research communications, (15): [PMID:2475111]
9. Davies, A A and 6 more authors.. (1989) CD59, an LY-6-like protein expressed in human lymphoid cells, regulates the action of the complement membrane attack complex on homologous cells.. The Journal of experimental medicine, (1): [PMID:2475570]
10. Sawada, R R and 5 more authors.. (1989) Complementary DNA sequence and deduced peptide sequence for CD59/MEM-43 antigen, the human homologue of murine lymphocyte antigen Ly-6C.. Nucleic acids research, (25): [PMID:2476718]
11. Sugita, Y Y and 9 more authors.. (1989) Molecular cloning and characterization of MACIF, an inhibitor of membrane channel formation of complement.. Journal of biochemistry, [PMID:2606909]
12. Kieffer, B B and 5 more authors.. (1994) Three-dimensional solution structure of the extracellular region of the complement regulatory protein CD59, a new cell-surface protein domain related to snake venom neurotoxins.. Biochemistry, (19): [PMID:7512825]
13. Fletcher, C M CM, Harrison, R A RA, Lachmann, P J PJ and Neuhaus, D D.. (1994) Structure of a soluble, glycosylated form of the human complement regulatory protein CD59.. Structure (London, England : 1993), (15): [PMID:7520819]
14. Sugita, Y Y and 6 more authors.. (1993) Determination of carboxyl-terminal residue and disulfide bonds of MACIF (CD59), a glycosyl-phosphatidylinositol-anchored membrane protein.. Journal of biochemistry, [PMID:8276756]
15. Meri, S S, Lehto, T T, Sutton, C W CW, Tyynelä, J J and Baumann, M M.. (1996) Structural composition and functional characterization of soluble CD59: heterogeneity of the oligosaccharide and glycophosphoinositol (GPI) anchor revealed by laser-desorption mass spectrometric analysis.. The Biochemical journal, (15): [PMID:8670172]
16. Bodian, D L DL, Davis, S J SJ, Morgan, B P BP and Rushmere, N K NK.. (1997) Mutational analysis of the active site and antibody epitopes of the complement-inhibitory glycoprotein, CD59.. The Journal of experimental medicine, (3): [PMID:9053451]
17. Rudd, P M PM and 7 more authors.. (1997) The glycosylation of the complement regulatory protein, human erythrocyte CD59.. The Journal of biological chemistry, (14): [PMID:9054419]
18. Yu, J J and 5 more authors.. (1997) Mapping the regions of the complement inhibitor CD59 responsible for its species selective activity.. Biochemistry, (5): [PMID:9235986]
19. Acosta, J J and 6 more authors.. (2000) Molecular basis for a link between complement and the vascular complications of diabetes.. Proceedings of the National Academy of Sciences of the United States of America, (9): [PMID:10805801]
20. Nevo, Yoram Y and 15 more authors.. (2013) CD59 deficiency is associated with chronic hemolysis and childhood relapsing immune-mediated polyneuropathy.. Blood, (3): [PMID:23149847]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Recombinant Human CD59 Protein, ≥95% (SDS-PAGE), high purity

Basic Description

Product Specifications

Certificates

Certificate of Analysis(COA)

Related Documents

FAQs and Articles

References

Solution Calculators

Molarity Calculator

Dilution Calculator

Reconstitution Calculator