Recombinant Human CD68 Protein

Item Number

rp175904

• Product Name: Recombinant Human CD68 Protein
• Synonyms: CD_antigen: CD68 | CD68 antigen | CD68 molecule | CD68 | DKFZp686M18236 | gp110 | LAMP4 | macrophage antigen CD68 | Macrosialin | SCARD1 | SRD1 | scavenger receptor class D, member 1 | SR-D1 | CD 68 | CD68_HUMAN
• Grade: Animal Free, Azide Free, Carrier Free
• Specifications & Purity: Animal Free, Carrier Free, Azide Free, ≥90%(SDS-PAGE)
• Endotoxin Concentration: ＜1.0 EU/μg
• Expression System: HEK293
• Amino Acids: 22-319 aa
• Sequence: NDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFS
• Protein Tag: C-His
• Predicted molecular weight: 32.4 kDa
• SDS-PAGE: 72.9-125.0 kDa, under reducing conditions; 72.9-125.0 kDa, under non-reducing conditions

Product Description

Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Macrosialin, also known as CD68 and Gp11, is a single-pass type I membrane protein which belongs to theLAMP family. CD68 is highly expressed by blood monocytes and tissue macrophages. It is also expressed in lymphocytes, fibroblasts and endothelial cells. CD68 is expressed in many tumor cell lines which could allow them to attach to selectins on vascular endothelium, facilitating their dissemination to secondary sites. CD68 plays a role in phagocytic activities of tissue macrophages, both in intracellular lysosomal metabolism and extracellular cell-cell and cell-pathogen interactions. It is a commonly used marker for macrophages. However, a number of studies have shown that CD68 antibodies react with other hematopoietic and non-hematopoietic cell types, suggesting that CD68 may not be a macrophage-specific antigen. CD68 binds to tissue- and organ-specific lectins or selectins, allowing homing of macrophage subsets to particular sites. Rapid recirculation of CD68 from endosomes and lysosomes to the plasma membrane may allow macrophages to crawl over selectin-bearing substrates or other cells.