| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp176728-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $89.90 | |
| rp176728-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $269.90 | |
| rp176728-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $429.90 | |
| rp176728-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,569.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F cell, C-His tag, 1-180 aa
| Product Name | Recombinant Human CD7 Protein |
|---|---|
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free |
| Product Description | CD7, also known as Leu-9, is an approximately 40 kDa glycosylated and palmitoylated transmembrane protein in the immunoglobulin superfamily. Mature human CD7 consists of a 155 amino acid (aa) extracellular domain (ECD), a 21 aa transmembrane segment, and a 39 aa cytoplasmic domain. Within the ECD, human CD7 shares 43% and 41% aa sequence identity with mouse and rat CD7, respectively. CD7 is expressed on T cells, NK cells, myeloid progenitor cells, and CD19+ B progenitor cells. Among CD8+ T cells, the CD7-bright population preferentially contains naïve and memory cells, while more weak expressors are primarily effector cells. CD7 associates in cis with CD3 and CD45 and in trans with SECTM1. Ligation of CD7 with antibodies or SECTM1 co‑stimulates the activation and proliferation of CD4+ and CD8+ T cells and NK cells. It also enhances integrin-mediated adhesion of these cells to Fibronectin, ICAM-1, and VCAM-1. CD7 additionally mediates the Galectin-1 induced apoptosis of T cells and facilitates the fusion of HIV-1 with target cells. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥95%(SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human CD7 protein (rp176728) at 1.0 μg/mL can bind CD7 Mouse mAb (Ab095225) with the EC50 of 53.82 ng/mL. |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 1-180 aa |
| Sequence | MAGPPRLLLLPLLLALARGLPGALAAQEVQQSPHCTTVPVGASVNITCSTSGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTITMHRLQLSDTGTYTCQAITEVNVYGSGTLVLVTEEQSQGWHRCSDAPPRASALPAPPTGSALPDPQTASALPDPPAASALPHHHHHH |
| Protein Tag | C-His |
| Predicted molecular weight | 16.4 kDa |
| SDS-PAGE | 22.3-39.5 kDa, under reducing conditions; 22.8-38.0 & 21.7 kDa, under non-reducing conditions |
Recombinant Human CD7 Protein (rp176728) - ELISA
Immobilized Recombinant Human CD7 Protein (rp176728) at 1.0 μg/mL can bind CD7 Mouse mAb (Ab095225) with the EC50 of 53.82 ng/mL.
Recombinant Human CD7 Protein (rp176728) - SDS-PAGE
3 μg/lane of Recombinant Human CD7 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 22.3-39.5 kDa under reducing conditions and 22.8-38.0 & 21.7 kDa under non-reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24R0800865 | Certificate of Analysis | Aug 02, 2024 | rp176728 |
