| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp181592-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp181592-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
| rp181592-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $599.90 | |
| rp181592-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,999.90 |
Animal Free, ≥90% (SDS-PAGE), 293F cell, C-His tag, 117-359 aa
| Product Name | Recombinant Human CD72 Protein |
|---|---|
| Grade | Animal Free, Carrier Free |
| Product Description | CD72, also known as Lyb‑2, is a 40‑45 kDa type II transmembrane glycoprotein that plays a role in immune system regulation. Mature human CD72 consists of a 95 amino acid (aa) cytoplasmic domain with two immunoreceptor tyrosine‑based inhibitory motifs (ITIMs), a 21 aa transmembrane segment, and a 243 aa extracellular domain with a coiled‑coil domain and a C‑type lectin domain. Within the ECD, human CD72 shares 48% and 44% aa sequence identity with mouse and rat CD72, respectively. CD72 is expressed on B lineage cells, NK cells, monocytes, dendritic cells, and mast cells. CD72 binds to CD5 with mouse/human cross‑reactivity and to Semaphorin 4D/CD100. It associates with CD79A in the B cell antigen receptor (BCR) complex following antigen stimulation and dampens BCR signaling through interactions with the phosphatase SHP‑1. CD72 ligation with antibodies or with Semaphorin 4D induces tyrosine dephosphorylation of the CD72 cytoplasmic domain and its dissociation from SHP‑1, leading to B cell proliferation. Both CD72 and Semaphorin 4D are required for the maintenance of B cell anergy and the regulation of peripheral B cell tolerance as shown by the development of autoimmunity in mice that lack either molecule. In addition to its negative regulation of BCR signaling, CD72 can induce positive signaling in B cells independent of the BCR. CD72 binding to Semaphorin 4D induces cytokine production by monocytes and dendritic cells, inhibits SCF R/c‑kit induced mast cell proliferation and activation, and inhibits the cytolytic activity of NK cells. Semaphorin 4D is expressed on activated NK cells and contributes to the adhesive interaction between NK and CD72+ target cells leading to a more efficient killing and enhanced IFN-gamma secretion. |
| Specifications & Purity | Animal Free, Carrier Free, ≥90%(SDS-PAGE) |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 117-359 aa |
| Sequence | RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPDHHHHHH |
| Protein Tag | C-His |
| Predicted molecular weight | 28.9 kDa |
| SDS-PAGE | 30.6-37.0 kDa, under reducing conditions |
Recombinant Human CD72 Protein (rp181592) - SDS-PAGE
3 μg/lane of Recombinant Human CD72 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 30.6-37.0 kDa.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0707709 | Certificate of Analysis | Jul 05, 2024 | rp181592 |
| ZJ24F0707710 | Certificate of Analysis | Jul 05, 2024 | rp181592 |
| ZJ24F0707711 | Certificate of Analysis | Jul 05, 2024 | rp181592 |
| ZJ24R0600646 | Certificate of Analysis | Jun 10, 2024 | rp181592 |
