Recombinant Human CD79a Protein

Features and benefits

Item Number

rp181593

Grouped product items
SKU	Size	Availability	Price
rp181593-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free!	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$139.90
rp181593-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$399.90
rp181593-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$599.90
rp181593-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,999.90

Animal Free, ≥95% (SDS-PAGE), 293F cell, C-His tag, 1-143 aa

View related series

Basic Description

Product Name	Recombinant Human CD79a Protein
Grade	Animal Free, Carrier Free
Product Description	Protein Function: Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B cells.
Specifications & Purity	Animal Free, Carrier Free, ≥95%(SDS-PAGE)
Endotoxin Concentration	＜1.0 EU/μg
Expression System	HEK293
Amino Acids	1-143 aa
Sequence	MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRHHHHHH
Protein Tag	C-His
Predicted molecular weight	13.3 kDa
SDS-PAGE	27.0-49.0 kDa, under reducing conditions

Product Specifications

Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Certificates

Enter Lot Number to search for COA:

To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section

4 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0707712	Certificate of Analysis	Jul 05, 2024	rp181593
ZJ24F0707713	Certificate of Analysis	Jul 05, 2024	rp181593
ZJ24F0707714	Certificate of Analysis	Jul 05, 2024	rp181593
ZJ24R0600707	Certificate of Analysis	Jun 23, 2024	rp181593

Solution Calculators

Determine the necessary mass, volume, or concentration for preparing a solution.

Determine the dilution needed to prepare a stock solution.

Basic Description