Determine the necessary mass, volume, or concentration for preparing a solution.
Activity Type | Activity Value -log(M) | Mechanism of Action | Activity Reference | Publications (PubMed IDs) |
---|
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp144109-10μg (Trial Size) Apply for free trial size(?) Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $99.90 | |
rp144109-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $259.90 | |
rp144109-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $469.90 | |
rp144109-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, ≥95% (SDS-PAGE), Active, HEK293, C-His tag, 29-159 aa
Product Name | Recombinant Human CD79B Protein, ≥95% (SDS-PAGE), high purity |
---|---|
Synonyms | AGM6; B cell antigen receptor complex associated protein beta chain; B cell specific glycoprotein B29; B-cell antigen receptor complex-associated protein beta chain; B-cell-specific glycoprotein B29; B29; B29/Ig-beta/CD79b; CD 79b; CD79b; CD79b antigen; C |
Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
Purity | ≥95% (SDS-PAGE) |
Species | Human |
Amino Acids | 29-159 aa |
Sequence | ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDHHHHHH |
Protein Tag | C-His tag |
Accession # | P40259 |
Predicted molecular weight | 15 kDa |
SDS-PAGE | 25-40 kDa, under reducing conditions |
Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
Activity Type | Activity Value -log(M) | Mechanism of Action | Activity Reference | Publications (PubMed IDs) |
---|
Form | Lyophilized |
---|---|
Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Dry ice |
Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
Lot Number | Certificate Type | Date | Item |
---|---|---|---|
ZJ24F0506241 | Certificate of Analysis | May 31, 2024 | rp144109 |
ZJ24F0506240 | Certificate of Analysis | May 31, 2024 | rp144109 |
ZJ24F0506239 | Certificate of Analysis | May 31, 2024 | rp144109 |