Skip to the beginning of the images gallery

Recombinant Human CD79B Protein, ≥95% (SDS-PAGE), high purity

≥95%(SDS-PAGE)

Features and benefits

Expression System: HEK293
Accession #: P40259
Protein Tag: C-His
Bioactivity: Immobilized recombinant Human CD79B at 0.5 μg/mL (100 μL/well) can bind CD79B antibody with a linear range of 0.1-1.2 ng/mL.
Endotoxin Concentration: ＜0.1 EU/μg

Item Number

rp144109

Grouped product items
SKU	Size	Availability	Price
rp144109-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$99.90
rp144109-50μg	50μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$259.90
rp144109-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$469.90
rp144109-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,599.90

Animal Free, ≥95% (SDS-PAGE), Active, HEK293, C-His tag, 29-159 aa

View related series

Accession#:P40259 CD79B Gene ID:974

Basic Description

Product Name	Recombinant Human CD79B Protein, ≥95% (SDS-PAGE), high purity
Synonyms	AGM6; B cell antigen receptor complex associated protein beta chain; B cell specific glycoprotein B29; B-cell antigen receptor complex-associated protein beta chain; B-cell-specific glycoprotein B29; B29; B29/Ig-beta/CD79b; CD 79b; CD79b; CD79b antigen; C
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description	Purity ≥95% (SDS-PAGE) Endotoxin level ＜0.1 EU/μg Function Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity	≥95% (SDS-PAGE)
Bioactivity	Immobilized recombinant Human CD79B at 0.5 μg/mL (100 μL/well) can bind CD79B antibody with a linear range of 0.1-1.2 ng/mL.
Endotoxin Concentration	＜0.1 EU/μg
Expression System	HEK293
Species	Human
Amino Acids	29-159 aa
Sequence	ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDHHHHHH
Protein Tag	C-His
Accession #	P40259
Predicted molecular weight	15 kDa
SDS-PAGE	25-40 kDa, under reducing conditions

Product Specifications

Form	Lyophilized
Reconstitution	Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section

3 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0506241	Certificate of Analysis	May 31, 2024	rp144109
ZJ24F0506240	Certificate of Analysis	May 31, 2024	rp144109
ZJ24F0506239	Certificate of Analysis	May 31, 2024	rp144109

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.