| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp176729-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $89.90 | |
| rp176729-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $249.90 | |
| rp176729-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
| rp176729-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, ≥90% (SDS-PAGE), Active, 293F cell, C-His tag, 1-159 aa
| Product Name | Recombinant Human CD79B Protein |
|---|---|
| Synonyms | B cell antigen receptor complex associated protein beta chain | B cell specific glycoprotein B29 | B-cell antigen receptor complex-associated protein beta chain | B-cell-specific glycoprotein B29 | B29 | B29/Ig-beta/CD79b | CD 79b | CD79b | CD79b antigen |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free |
| Product Description | Required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Enhances phosphorylation of CD79A, possibly by recruiting kinases which phosphorylate CD79A or by recruiting proteins which bind to CD79A and protect it from dephosphorylation. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥90%(SDS-PAGE) |
| Bioactivity | 1. Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab (anti-CD79b) (Ab175715) with the EC50 of 11.08 ng/mL. 2. Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab vedotin-piiq (an |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 1-159 aa |
| Sequence | MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDHHHHHH |
| Protein Tag | C-His |
| N-terminal Sequence | Ala29 |
| Predicted molecular weight | 16.0 kDa |
| SDS-PAGE | 26.8-38.0 kDa, under reducing conditions; 28.8-34.6 kDa, under non-reducing conditions |
Recombinant Human CD79B Protein (rp176729) - ELISA
Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab (anti-CD79b) (Ab175715) with the EC₅₀ of 11.08 ng/mL.
Recombinant Human CD79B Protein (rp176729) - ELISA
Immobilized Recombinant Human CD79B Protein (rp176729) at 1.0 μg/mL can bind Polatuzumab vedotin-piiq (anti-CD79b) (Ab175635) with the EC₅₀ of 51.95 ng/mL.
Recombinant Human CD79B Protein (rp176729) - SDS-PAGE
3 μg/lane of Recombinant Human CD79B Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 26.8-38.0 kDa under reducing conditions and 28.8-34.6 kDa under non-reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0708340 | Certificate of Analysis | Jul 19, 2024 | rp176729 |
| ZJ24F0708339 | Certificate of Analysis | Jul 19, 2024 | rp176729 |
| ZJ24F0708338 | Certificate of Analysis | Jul 19, 2024 | rp176729 |
| ZJ24R0700768 | Certificate of Analysis | Jul 06, 2024 | rp176729 |
