Recombinant Human CD80 Protein, >95% (SDS-PAGE), high purity

Features and benefits
  • Expression System: HEK293
  • Accession #: P33681
  • Protein Tag: His
  • Bioactivity: Measured by its binding activity of recombinant human CD80 and recombinant human CD86. The EC50 for this effect is less than 0.412μg/mL.
  • Endotoxin Concentration: <1.0 EU/μg
Item Number
rp144122
Grouped product items
SKUSizeAvailabilityPrice Qty
rp144122-25μg
25μg
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
$129.90
rp144122-100μg
100μg
Available within 4-8 weeks(?)
Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!
$379.90
rp144122-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$2,589.90

Animal Free, >95% (SDS-PAGE), Active, 293F cell, His-tag, 35-242 aa

Basic Description

Product NameRecombinant Human CD80 Protein, >95% (SDS-PAGE), high purity
SynonymsActivation B7-1 antigen | B7 | BB1 | CTLA-4 counter-receptor B7.1
GradeActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description

Purity

>95% SDS-PAGE.


Molecular weight informat

The protein migrates as 65-90 kDa under reducing condition due to glycosylation.


Function

Involved in the costimulatory signal essential for T-lymphocyte activation. T-cell proliferation and cytokine production is induced by the binding of CD28 or CTLA-4 to this receptor.

Specifications & PurityActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity>95% (SDS-PAGE)
BioactivityMeasured by its binding activity of recombinant human CD80 and recombinant human CD86. The EC50 for this effect is less than 0.412μg/mL.
Endotoxin Concentration<1.0 EU/μg
Expression SystemHEK293
SpeciesHuman
Amino Acids35-242 aa
SequenceVIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIW PEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEV TLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEEL NAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFN WNTTKQEHFPDN
Protein TagHis
Accession #P33681
Predicted molecular weight25.5 kDa

Images

Recombinant Human CD80 Protein (rp144122) - Protein Bioactivity
Measured by its binding activity of recombinant human CD80 and recombinant human CD86. The EC₅₀ for this effect is less than 0.412 μg/mL.

Recombinant Human CD80 Protein (rp144122) - SDS-PAGE
2.5 μg/lane of Recombinant Human CD80 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 50.2 kDa.

Product Specifications

FormLyophilized
ReconstitutionReconstitute in 10mM PBS (pH7.4) to a concentration of 0.1-1.0 mg/mL. Do not Vortex.
Storage TempStore at -20°C
Shipped InIce chest + Ice pads
Stability And StorageAvoid repeated freeze/thaw cycles. Store at 2-8 ℃ for one month. Aliquot and store at -80℃ for 12 months.

Certificates

C of A & Other Certificates(BSE/TSE, COO)

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeDateItem
ZJ23F0700615Certificate of AnalysisJul 20, 2023 rp144122
ZJ23F0700614Certificate of AnalysisJul 20, 2023 rp144122

Related Documents

References

1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P et al..  (2004)  The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)..  Genome Res,  14  (10B): (2121-7).  [PMID:15489334] [10.1021/op500134e]
2. Vicente Rabaneda EF, Herrero-Beaumont G, Castañeda S.  (2013)  Update on the use of abatacept for the treatment of rheumatoid arthritis..  Expert Rev Clin Immunol,  (7): (599-621).  [PMID:23899231] [10.1021/op500134e]
3. Linsley PS, Brady W, Urnes M, Grosmaire LS, Damle NK, Ledbetter JA.  (1991)  CTLA-4 is a second receptor for the B cell activation antigen B7..  J Exp Med,  174  (3): (561-9).  [PMID:1714933] [10.1021/op500134e]
4. Selvakumar, A A and 5 more authors..  (1992)  Genomic organization and chromosomal location of the human gene encoding the B-lymphocyte activation antigen B7..  Immunogenetics,      [PMID:1377173]
5. Freeman, G J GJ and 8 more authors..  (1991)  Structure, expression, and T cell costimulatory activity of the murine homologue of the human B lymphocyte activation antigen B7..  The Journal of experimental medicine,    (1):   [PMID:1714935]
6. Freeman, G J GJ and 5 more authors..  (1989)  B7, a new member of the Ig superfamily with unique expression on activated and neoplastic B cells..  Journal of immunology (Baltimore, Md. : 1950),    (15):   [PMID:2794510]
7. Lanier, L L LL and 7 more authors..  (1995)  CD80 (B7) and CD86 (B70) provide similar costimulatory signals for T cell proliferation, cytokine production, and generation of CTL..  Journal of immunology (Baltimore, Md. : 1950),    (1):   [PMID:7527824]
8. Vandenborre, K K and 5 more authors..  (1999)  Interaction of CTLA-4 (CD152) with CD80 or CD86 inhibits human T-cell activation..  Immunology,      [PMID:10583602]
9. Ikemizu, S S and 7 more authors..  (2000)  Structure and dimerization of a soluble form of B7-1..  Immunity,      [PMID:10661405]
10. Stamper, C C CC and 9 more authors..  (2001)  Crystal structure of the B7-1/CTLA-4 complex that inhibits human immune responses..  Nature,    (29):   [PMID:11279502]
11. Chen, X X, Ji, Z L ZL and Chen, Y Z YZ..  (2002)  TTD: Therapeutic Target Database..  Nucleic acids research,    (1):   [PMID:11752352]
12. Gottlieb, Alice B AB and 8 more authors..  (2004)  Evaluation of safety and clinical activity of multiple doses of the anti-CD80 monoclonal antibody, galiximab, in patients with moderate to severe plaque psoriasis..  Clinical immunology (Orlando, Fla.),      [PMID:15093549]
13. Czuczman, Myron S MS and 13 more authors..  (2005)  Phase I/II study of galiximab, an anti-CD80 antibody, for relapsed or refractory follicular lymphoma..  Journal of clinical oncology : official journal of the American Society of Clinical Oncology,    (1):   [PMID:15994148]
14. and Kremer, Joel M JM..  (2005)  Selective costimulation modulators: a novel approach for the treatment of rheumatoid arthritis..  Journal of clinical rheumatology : practical reports on rheumatic & musculoskeletal diseases,      [PMID:16357751]
15. Hervey, Pauline S PS and Keam, Susan J SJ..  (2006)  Abatacept..  BioDrugs : clinical immunotherapeutics, biopharmaceuticals and gene therapy,      [PMID:16573350]
16. Muzny, Donna M DM and 113 more authors..  (2006)  The DNA sequence, annotation and analysis of human chromosome 3..  Nature,    (27):   [PMID:16641997]
17. Weyand, Cornelia M CM and Goronzy, Jörg J JJ..  (2006)  T-cell-targeted therapies in rheumatoid arthritis..  Nature clinical practice. Rheumatology,      [PMID:16932686]
18. and Scheinfeld, Noah N..  (2006)  Abatacept: A review of a new biologic agent for refractory rheumatoid arthritis for dermatologists..  The Journal of dermatological treatment,      [PMID:16971318]
19. Tedesco Silva, Helio H, Pinheiro Machado, Paula P, Rosso Felipe, Claudia C and Medina Pestana, Jose Osmar JO..  (2006)  Immunotherapy for De Novo renal transplantation: what's in the pipeline?.  Drugs,      [PMID:16978033]
20. Vincenti, Flavio F and Luggen, Michael M..  (2007)  T cell costimulation: a rational target in the therapeutic armamentarium for autoimmune diseases and transplantation..  Annual review of medicine,      [PMID:17020493]
21. Nogid, Anna A and Pham, David Q DQ..  (2006)  Role of abatacept in the management of rheumatoid arthritis..  Clinical therapeutics,      [PMID:17212998]
22. Leonard, J P JP and 14 more authors..  (2007)  A phase I/II study of galiximab (an anti-CD80 monoclonal antibody) in combination with rituximab for relapsed or refractory, follicular lymphoma..  Annals of oncology : official journal of the European Society for Medical Oncology,      [PMID:17470451]
23. Kakoulidou, M M, Giscombe, R R, Zhao, X X, Lefvert, A K AK and Wang, X X..  (2007)  Human Soluble CD80 is generated by alternative splicing, and recombinant soluble CD80 binds to CD28 and CD152 influencing T-cell activation..  Scandinavian journal of immunology,      [PMID:17953528]
24. Reynolds, Jennifer J, Shojania, Kam K and Marra, Carlo A CA..  (2007)  Abatacept: a novel treatment for moderate-to-severe rheumatoid arthritis..  Pharmacotherapy,      [PMID:18041889]
25. Maxwell, Lara J LJ and Singh, Jasvinder A JA..  (2010)  Abatacept for rheumatoid arthritis: a Cochrane systematic review..  The Journal of rheumatology,      [PMID:20080922]
26. Zhou, Houjiang H and 6 more authors..  (2013)  Toward a comprehensive characterization of a human cancer cell phosphoproteome..  Journal of proteome research,    (4):   [PMID:23186163]
27. Kleinpeter, Patricia and 20 more authors..  (2019)  By Binding CD80 and CD86, the Vaccinia Virus M2 Protein Blocks Their Interactions with both CD28 and CTLA4 and Potentiates CD80 Binding to PD-L1..  Journal of virology,    (1):   [PMID:30918073]

Solution Calculators