Recombinant Human CD90/Thy1 Protein

Item Number

rp183754

• Product Name: Recombinant Human CD90/Thy1 Protein
• Grade: ActiBioPure™, Animal Free, Bioactive, Carrier Free
• Specifications & Purity: Animal Free, Carrier Free, ActiBioPure™, Bioactive, ≥95%(SDS-PAGE)
• Bioactivity: Immobilized Recombinant Human CD90/Thy1 Protein (rp183754) at 2.0 μg/mL can bind CD90/Thy1 Mouse mAb (Ab095497) with the EC50 of 287.4 ng/mL.​
• Endotoxin Concentration: <1 EU/μg
• Expression System: HEK293
• Amino Acids: 1-130 aa
• Sequence: MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCHHHHHH
• Protein Tag: C-His
• Predicted molecular weight: 13.4 kDa
• SDS-PAGE: 16.8-33.2 kDa, under reducing condition; 16.8-33.2 kDa, under non-reducing condition

Product Description

Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining
Description:
CD90, also known as Thy1, is an approximately 25-35 kDa glycoprotein that mediates cellular adhesion and exerts wide-ranging effects in different tissues. CD90 is expressed on hematopoietic progenitor cells, neurons, and activated vascular endothelial cells. Its species-specific expression in lymphoid cells allows its use as a thymocyte and pan T cell marker in mice but not in humans. CD90 can form dimers and higher-order multimers. It binds to heparin, the proteoglycan Syndecan-4, and Integrins alpha M beta 2, alpha V beta 3, and alpha V beta 5. Through these interactions, CD90 inhibits neurite outgrowth, promotes astrocyte adhesion, mediates the adhesion and extravasation of leukocytes and melanoma cells, supports Thrombospondin-1-induced disassembly of fibroblast focal adhesions, and inhibits the activation of latent TGF-beta 1, myofibroblast differentiation, and lung fibrosis. Human Thy-1 shares 63% and 66% amino acid similarity with mouse and rat homologs.