Recombinant Human CD98 Protein, ≥95% (SDS-PAGE), high purity

Item Number

rp144163

• Product Name: Recombinant Human CD98 Protein, ≥95% (SDS-PAGE), high purity
• Synonyms: 4F2; 4F2 cell surface antigen heavy chain; 4F2 cell-surface antigen heavy chain; 4F2 heavy chain; 4F2 heavy chain antigen; 4F2_HUMAN; 4F2hc; 4T2HC; Antigen defined by monoclonal antibody 4F2 heavy chain; Antigen identified by monoclonal antibodies 4F2 TRA
• Grade: ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
• Specifications & Purity: ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
• Purity: ≥95% (SDS-PAGE)
• Bioactivity: Immobilized Human CD98 Protein at 5 μg/mL (100 μL/well) can bind ITGB1 with a linear range of 20-1200 ng/mL.
• Endotoxin Concentration: ＜0.1 EU/μg
• Expression System: HEK293
• Species: Human
• Amino Acids: 206-630 aa
• Sequence: HHHHHHRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQ
• Protein Tag: N-His
• Accession #: P08195
• Predicted molecular weight: 47 kDa
• SDS-PAGE: 50-60 kDa, under reducing conditions

Product Description

Purity
≥95% (SDS-PAGE)
Endotoxin level
＜0.1 EU/μg
Function
Required for the function of light chain amino-acid transporters. Involved in sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan. Involved in guiding and targeting of LAT1 and LAT2 to the plasma membrane. When associated with SLC7A6 or SLC7A7 acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Required for normal and neoplastic cell growth. When associated with SLC7A5/LAT1, is also involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. When associated with SLC7A5 or SLC7A8, involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Together with ICAM1, regulates the transport activity LAT2 in polarized intestinal cells, by generating and delivering intracellular signals. When associated with SLC7A5, plays an important role in transporting L-leucine from the circulating blood to the retina across the inner blood-retinal barrier."