| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp144165-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp144165-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $359.90 | |
| rp144165-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $529.90 | |
| rp144165-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,949.90 |
Animal Free, >95%(SDS-PAGE), Active, 293F, Fc&His tag, 23-122 aa
| Product Name | Recombinant Human CD99 Protein, ＞95%(SDS-PAGE), high purity |
|---|---|
| Synonyms | 120000000 | Antigen identified by monoclonal 12E7, Y homolog | Antigen identified by monoclonal antibodies 12E7, F21 and O13 | CD99 | CD99 antigen | CD99 molecule | CD99_HUMAN | Cell surface antigen 12E7 | Cell surface antigen HBA 71 | Cell surface antige |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity >95% SDS-PAGE. Additional sequence information FC tag at C terminus. Extracellular domain. Function Involved in T-cell adhesion processes. It is involved in spontaneous rosette formation with erythrocytes. Post-translational Extensively O-glycosylated. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ＞95%(SDS-PAGE) |
| Bioactivity | Immobilized CD99 Mouse mAb (Ab006798) at 2.0 μg/mL can bind biotinylated Recombinant Human CD99 Protein (rp144165) , the EC50 for this effect is 13.15 ng/mL. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 23-122 aa |
| Sequence | DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
| Protein Tag | C-Fc & His |
| Accession # | P14209-1 |
| Predicted molecular weight | 39 kDa |
| SDS-PAGE | 51.8 kDa, under reducing conditions; 105.6 kDa, under non-reducing conditions. |
Recombinant Human CD99 Protein (rp144165) - Protein Bioactivity
Immobilized CD99 Mouse mAb (Ab006798) at 2.0 μg/mL can bind biotinylated Recombinant Human CD99 Protein (rp144165), the EC₅₀ for this effect is 13.15 ng/mL.
Recombinant Human CD99 Protein (rp144165) - SDS-PAGE
3 μg/lane of Recombinant Human CD99 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 51.8 kDa under reducing conditions and 105.6 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in water to a concentration of 0.1-1.0 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0505402 | Certificate of Analysis | May 15, 2024 | rp144165 |
| ZJ24F0505401 | Certificate of Analysis | May 15, 2024 | rp144165 |
| ZJ24F0505400 | Certificate of Analysis | May 15, 2024 | rp144165 |
