| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp144254-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp144254-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $469.90 | |
| rp144254-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $759.90 | |
| rp144254-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,939.90 |
Animal Free, ≥95% (SDS-PAGE), Active, E.coli, C-His tag, 35-155 aa
| Product Name | Recombinant Human CEACAM-3/CD66d Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | Carcinoembryonic antigen CGM1 | carcinoembryonic | Carcinoembryonic antigen CGM1 | Carcinoembryonic antigen gene family member 1 | carcinoembryonic antigen related cell adhesion molecule 3 | Carcinoembryonic antigen-related cell adhesion molecule 3 | cd66 |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | When Recombinant Human CEACAM‑3/CD66d is immobilized at 2 µg/mL (100 µL/well), the concentration of Recombinant Human CEACAM-7 that produces 50% of the optimal binding response is 0.6-3.6 μg/mL. |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Species | Human |
| Amino Acids | 35-155 aa |
| Sequence | MKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGHHHHHH |
| Protein Tag | C-His |
| Accession # | P40198 |
| Predicted molecular weight | 14 kDa |
| SDS-PAGE | 15 - 20 kDa, under reducing conditions; 15 - 20 kDa, under non-reducing conditions. |
Recombinant Human CEACAM-3/CD66d Protein (rp144254) - Protein Bioactivity
Immobilized Recombinant Human CEACAM-3/CD66d Protein (rp144254) at 2.0 μg/mL, the concentration of Recombinant Human CEACAM-7 that produces 50% of the optimal binding response is 2.2 μg/mL.
Recombinant Human CEACAM-3/CD66d Protein (rp144254) - SDS-PAGE
3 μg/lane of Recombinant Human CEACAM-3/CD66d Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 15 - 20 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Wet ice |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
| 1. Khan, W N WN and 5 more authors.. (1992) Identification of three new genes and estimation of the size of the carcinoembryonic antigen family.. Genomics, [PMID:1427854] |
| 2. Kuroki, M M and 6 more authors.. (1991) Molecular cloning of nonspecific cross-reacting antigens in human granulocytes.. The Journal of biological chemistry, (25): [PMID:2050678] |
| 3. Nagel, G G and 5 more authors.. (1993) Genomic organization, splice variants and expression of CGM1, a CD66-related member of the carcinoembryonic antigen gene family.. European journal of biochemistry, (15): [PMID:8508798] |
| 4. Streichert, T T and 5 more authors.. (2001) The microbial receptor CEACAM3 is linked to the calprotectin complex in granulocytes.. Biochemical and biophysical research communications, (23): [PMID:11708798] |
| 5. McCaw, Shannon E SE, Schneider, Jutta J, Liao, Edward H EH, Zimmermann, Wolfgang W and Gray-Owen, Scott D SD.. (2003) Immunoreceptor tyrosine-based activation motif phosphorylation during engulfment of Neisseria gonorrhoeae by the neutrophil-restricted CEACAM3 (CD66d) receptor.. Molecular microbiology, [PMID:12864848] |
| 6. Schmitter, Tim T, Agerer, Franziska F, Peterson, Lisa L, Munzner, Petra P and Hauck, Christof R CR.. (2004) Granulocyte CEACAM3 is a phagocytic receptor of the innate immune system that mediates recognition and elimination of human-specific pathogens.. The Journal of experimental medicine, (5): [PMID:14707113] |
