Recombinant Human Clusterin Protein, ＞90%(SDS-PAGE), high purity

Item Number

rp144473

• Product Name: Recombinant Human Clusterin Protein, ＞90%(SDS-PAGE), high purity
• Synonyms: 40; AAG4; Aging-associated gene 4 protein; aging-associated protein 4; Apo-J; APOJ; ApoJalpha; ApoJbeta; Apolipoprotein J; CLI; CLU; CLUS_HUMAN; Clusterin; Clusterin alpha chain; Complement cytolysis inhibitor; Complement cytolysis inhibitor a chain; Comp
• Grade: ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
• Specifications & Purity: ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥90%(SDS-PAGE)
• Purity: ＞90%(SDS-PAGE)
• Bioactivity: Measured by its ability to induce clustering of Caki‑2 human clear cell carcinoma epithelial cells.
• Endotoxin Concentration: ＜0.1 EU/μg
• Expression System: HEK293
• Species: Human
• Amino Acids: 23-449 aa
• Sequence: DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIRE
• Protein Tag: C-His
• Accession #: P10909-1
• Predicted molecular weight: 47 kDa
• SDS-PAGE: 36.2 kDa, under reducing conditions; 60.7 kDa, under non-reducing conditions.

Product Description

Purity

>90% SDS-PAGE.

Function

Isoform 1 functions as extracellular chaperone that prevents aggregation of nonnative proteins. Prevents stress-induced aggregation of blood plasma proteins. Inhibits formation of amyloid fibrils by APP, APOC2, B2M, CALCA, CSN3, SNCA and aggregation-prone LYZ variants (in vitro). Does not require ATP. Maintains partially unfolded proteins in a state appropriate for subsequent refolding by other chaperones, such as HSPA8/HSC70. Does not refold proteins by itself. Binding to cell surface receptors triggers internalization of the chaperone-client complex and subsequent lysosomal or proteasomal degradation. Secreted isoform 1 protects cells against apoptosis and against cytolysis by complement. Intracellular isoforms interact with ubiquitin and SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes and promote the ubiquitination and subsequent proteasomal degradation of target proteins. Promotes proteasomal degradation of COMMD1 and IKBKB. Modulates NF-kappa-B transcriptional activity. Nuclear isoforms promote apoptosis. Mitochondrial isoforms suppress BAX-dependent release of cytochrome c into the cytoplasm and inhibit apoptosis. Plays a role in the regulation of cell proliferation.

Post-translational

Isoform 1 is proteolytically cleaved on its way through the secretory system, probably within the Golgi lumen. Polyubiquitinated, leading to proteasomal degradation. Heavily N-glycosylated. About 30% of the protein mass is comprised of complex N-linked carbohydrate.