| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp169589-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | In stock | $99.90 | |
| rp169589-100μg | 100μg | In stock | $329.90 | |
| rp169589-1mg | 1mg | In stock | $1,799.90 |
Carrier Free, >90%(SDS-PAGE), E.coli, His tag, 1-166 aa
| Product Name | Recombinant Human Cofilin Protein, >90%(SDS-PAGE), high purity |
|---|---|
| Synonyms | CFL1; Cofilin 1; CFL; Cofilin 1 (Non-Muscle); 18 KDa Phosphoprotein; Cofilin-1; P18; Epididymis Secretory Protein Li 15; Cofilin; Non-Muscle Isoform; HEL-S-15; Cofilin |
| Grade | Azide Free, Carrier Free |
| Product Description | Purity:>90%, by SDS-PAGE visualized with Coomassie® Blue Staining. |
| Specifications & Purity | Carrier Free, Azide Free, ≥90%(SDS-PAGE) |
| Purity | >90%(SDS-PAGE) |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 1-166 aa |
| Sequence | MGSSHHHHHHSSGLVPRGSHMASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL |
| Protein Tag | N-His |
| Predicted molecular weight | 20.7 kDa |
| SDS-PAGE | 21.2 kDa, reducing conditions; 21.2 kDa, non-reducing conditions |
Recombinant Human Cofilin Protein (rp169589) - SDS-PAGE
Recombinant Human Cofilin Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 21.2 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C stable up to 1 year. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F1201881 | Certificate of Analysis | Dec 13, 2023 | rp169589 |
| ZJ23F1201880 | Certificate of Analysis | Dec 13, 2023 | rp169589 |
| ZJ23F1201879 | Certificate of Analysis | Dec 13, 2023 | rp169589 |
| ZJ23R1100167 | Certificate of Analysis | Nov 24, 2023 | rp169589 |
| 1. Nakashima S, Matsuda H, Kurume A, Oda Y, Nakamura S, Yamashita M, Yoshikawa M.. (2010) Cucurbitacin E as a new inhibitor of cofilin phosphorylation in human leukemia U937 cells.. Bioorg Med Chem Lett, 20 (9): (2994-2997). [PMID:20347305] |
| 2. Ogawa, K K and 6 more authors.. (1990) Coding sequence of human placenta cofilin cDNA.. Nucleic acids research, (11): [PMID:2263493] |
| 3. van der Steege, G G and 9 more authors.. (1995) A provisional transcript map of the spinal muscular atrophy (SMA) critical region.. European journal of human genetics : EJHG, [PMID:7552146] |
| 4. Davidson, M M MM and Haslam, R J RJ.. (1994) Dephosphorylation of cofilin in stimulated platelets: roles for a GTP-binding protein and Ca2+.. The Biochemical journal, (1): [PMID:8037689] |
| 5. Gillett, G T GT, Fox, M F MF, Rowe, P S PS, Casimir, C M CM and Povey, S S.. (1996) Mapping of human non-muscle type cofilin (CFL1) to chromosome 11q13 and muscle-type cofilin (CFL2) to chromosome 14.. Annals of human genetics, [PMID:8800436] |
| 6. Yeoh, Sharon S, Pope, Brian B, Mannherz, Hans G HG and Weeds, Alan A.. (2002) Determining the differences in actin binding by human ADF and cofilin.. Journal of molecular biology, (25): [PMID:11812157] |
| 7. Gevaert, Kris K and 6 more authors.. (2003) Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.. Nature biotechnology, [PMID:12665801] |
| 8. Nakano, Kuniko K and 6 more authors.. (2003) Cofilin phosphorylation and actin polymerization by NRK/NESK, a member of the germinal center kinase family.. Experimental cell research, (15): [PMID:12837278] |
| 9. Pope, Brian J BJ, Zierler-Gould, Karen M KM, Kühne, Ronald R, Weeds, Alan G AG and Ball, Linda J LJ.. (2004) Solution structure of human cofilin: actin binding, pH sensitivity, and relationship to actin-depolymerizing factor.. The Journal of biological chemistry, (6): [PMID:14627701] |
| 10. Andersen, Jens S JS and 5 more authors.. (2003) Proteomic characterization of the human centrosome by protein correlation profiling.. Nature, (4): [PMID:14654843] |
| 11. Gohla, Antje A, Birkenfeld, Jörg J and Bokoch, Gary M GM.. (2005) Chronophin, a novel HAD-type serine protein phosphatase, regulates cofilin-dependent actin dynamics.. Nature cell biology, [PMID:15580268] |
| 12. Leong, Wai Fook WF and Chow, Vincent T K VT.. (2006) Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection.. Cellular microbiology, [PMID:16548883] |
| 13. Bai, Siau Wei SW and 9 more authors.. (2011) Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.. BMC biology, (11): [PMID:21834987] |
| 14. Borroni, Elena M EM and 10 more authors.. (2013) β-arrestin-dependent activation of the cofilin pathway is required for the scavenging activity of the atypical chemokine receptor D6.. Science signaling, (30): [PMID:23633677] |
| 15. Kipper, Sarit S and 7 more authors.. (2015) New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.. Molecular & cellular proteomics : MCP, [PMID:25556234] |
| 16. Prudent, Renaud R and 8 more authors.. (2018) A quantitative proteomic analysis of cofilin phosphorylation in myeloid cells and its modulation using the LIM kinase inhibitor Pyr1.. PloS one, [PMID:30550596] |
