Recombinant Human CTLA-4 Protein

Item Number

rp176276

• Product Name: Recombinant Human CTLA-4 Protein
• Grade: ActiBioPure™, Animal Free, Bioactive, Carrier Free
• Specifications & Purity: ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥95%(SDS-PAGE)
• Bioactivity: Immobilized Recombinant Human CTLA-4 Protein (rp176276) at 1.0 μg/mL can bind Ipilimumab (anti-CTLA-4) (I411993) with the EC50 of 18.49 ng/mL.
• Endotoxin Concentration: <1 EU/μg
• Expression System: HEK293
• Amino Acids: 1-162 aa
• Sequence: MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFHHHHHH
• Protein Tag: C-His
• Predicted molecular weight: 14.5 kDa
• SDS-PAGE: 24.8 kDa, under reducing conditions

Product Description

Purity:≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Cytotoxic T-lymphocyte protein 4, also known as CTLA4 and CD152, is a single-pass type I membrane protein and a member of the immunoglobulin superfamily. It is the second member of the CD28 receptor family. The ligands or counterreceptors for these two proteins are the B7 family members, CD80 (B7-1) and CD86 (B7-2). CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Intracellular CTLA4 is also found in regulatory T cells and may play an important role in their functions. CD152 or cytotoxic T lymphocyte antigen-4 (CTLA-4) is an essential receptor involved in the negative regulation of T cell activation. Because of its profound inhibitory role, CD152 has been considered a sound susceptible candidate in autoimmunity and a persuasive target for cancer immunotherapy. In particular, recent evidence suggests that CD152 is also important in the homeostasis and function of a population of suppressive cells, termed regulatory T cells (Treg).