| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp183611-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $69.90 | |
| rp183611-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $199.90 | |
| rp183611-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $299.90 | |
| rp183611-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, ≥95% (SDS-PAGE), 293F cell, C-His tag, 1-237 aa
| Product Name | Recombinant Human CXADR Protein |
|---|---|
| Synonyms | CAR4/6 | coxsackie virus and adenovirus receptor | coxsackie virus B receptor | coxsackievirus and adenovirus receptor | CVB3 binding protein | CVB3 BP | CVB3-binding protein | CXADR | HCAR | HCVADR | CAR10Coxsackievirus B-adenovirus receptor |
| Grade | Animal Free, Carrier Free |
| Product Description | Protein Function: |
| Specifications & Purity | Animal Free, Carrier Free, ≥95%(SDS-PAGE) |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 1-237 aa |
| Sequence | MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLISPADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCKVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSDSQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGHHHHHH |
| Protein Tag | C-His |
| Predicted molecular weight | 24.8 kDa |
| SDS-PAGE | 29.0-34.0 kDa, under reducing conditions; 24.0-30.0 kDa, under non-reducing conditions |
Recombinant Human CXADR Protein (rp183611) - SDS-PAGE
3 μg/lane of Recombinant Human CXADR Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 29.0-34.0 kDa under reducing conditions and 24.0-30.0 kDa under non-reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0708021 | Certificate of Analysis | Jul 12, 2024 | rp183611 |
| ZJ24F0708020 | Certificate of Analysis | Jul 12, 2024 | rp183611 |
| ZJ24F0708019 | Certificate of Analysis | Jul 12, 2024 | rp183611 |
| ZJ24R0600710 | Certificate of Analysis | Jun 23, 2024 | rp183611 |
