| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp170434-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp170434-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $399.90 | |
| rp170434-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $599.90 | |
| rp170434-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, ≥90% (SDS-PAGE), Active, E. coli, No tag, 22-98 aa
| Product Name | Recombinant Human CXCL10/IP-10 Protein |
|---|---|
| Synonyms | chemokine (C-X-C motif) ligand 10 | CRG2 | CRG-2 | CXCL10 | gIP-10 | IFI10 | INP10 | IP-10 | mob-1 | SCYB10 | C7 |
| Grade | ActiBioPure™, Bioactive, Carrier Free |
| Product Description | Protein Function: |
| Specifications & Purity | ActiBioPure™, Bioactive, Carrier Free, ≥90%(SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human CXCL10/IP-10 Protein (rp170434) at 1.0 μg/mL can bind Eldelumab (anti-CXCL10) (Ab170882) with the EC50 of 268.7 ng/mL. |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 22-98 aa |
| Sequence | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
| Protein Tag | No tag |
| Predicted molecular weight | 20.8 kDa |
| SDS-PAGE | 11.3 kDa, under reducing conditions |
Recombinant Human CXCL10/IP-10 Protein (rp170434) - ELISA
Immobilized Recombinant Human CXCL10/IP-10 Protein (rp170434) at 1.0 μg/mL can bind Eldelumab (anti-CXCL10) (Ab170882) with the EC₅₀of 268.7 ng/mL.
Recombinant Human CXCL10/IP-10 Protein (rp170434) - SDS-PAGE
1 μg/lane of Recombinant Human CXCL10/IP-10 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 11.3 kDa under reducing conditions.
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0708056 | Certificate of Analysis | Jul 12, 2024 | rp170434 |
| ZJ24F0708055 | Certificate of Analysis | Jul 12, 2024 | rp170434 |
| ZJ24F0708054 | Certificate of Analysis | Jul 12, 2024 | rp170434 |
