| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp144864-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $99.90 | |
| rp144864-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $339.90 | |
| rp144864-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $539.90 | |
| rp144864-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,399.90 |
Animal Free, >97% (SDS-PAGE, HPLC), Active, E. coli, No tag, 41-114 aa
| Product Name | Recombinant Human CXCL5 Protein, ＞97% (SDS-PAGE, HPLC), high purity |
|---|---|
| Synonyms | chemokine (C-C motif) ligand 5; C-X-C motif chemokine 5; CXCL5; CXCL5/ENA-78; ENA78; ENA-78; ENA-78(1-78); Epithelial-derived neutrophil-activating protein 78; Neutrophil-activating peptide ENA-78; neutrophil-activating protein 78; SCYB5ENA78; AMCFII; C-X |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
| Product Description | Purity >97% SDS-PAGE or HPLC analyses. Endotoxin level is Less than 0.1EU/µg . Function Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. Post-translational N-terminal processed forms ENA-78(8-78) and ENA-78(9-78) are produced by proteolytic cleavage after secretion from peripheral blood monocytes. CXCL5 is a small cytokine also known as epithelial-derived neutrophil-activating peptide 78 (ENA-78). The protein is produced following stimulation of cells with the inflammatory cytokine interleukin-1 or tumor necrosis factor-alpha. In vitro, ENA-78 (8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. They are produced by proteolytic cleavage after secretion from peripheral blood monocytes. Recombinant human CXCL5 (5-78 a.a.) contains 74 amino acids and it is a single non-glycosylated polypeptide chain. Human CXCL5 shares 57% amino acid sequence identity with mouse and rat CXCL5. Recombinant Human ENA-78/CXCL5 is an 8.1kDa protein containing 74 amino acid residues.
|
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) |
| Purity | ＞97% (SDS-PAGE, HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 10.0-100.0 ng/ml. |
| Endotoxin Concentration | ＜0.1 EU/µg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 41-114 aa |
| Sequence | AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN |
| Protein Tag | No tag |
| Accession # | P42830 |
| Predicted molecular weight | 8.1 kDa |
Recombinant Human CXCL5 Protein ( rp144864) - Protein Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 10.0-100.0 ng/mL.
Recombinant Human CXCL5 Protein ( rp144864) - SDS-PAGE
2.5 μg/lane of Recombinant Human CXCL5 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 9.4 kDa under reducing conditions and 12.0 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Furth |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Upon delivery aliquot, Store at -20°C, Avoid freeze / thaw cycles. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0901074 | Certificate of Analysis | Sep 18, 2023 | rp144864 |
| ZJ23F0901073 | Certificate of Analysis | Sep 18, 2023 | rp144864 |
| ZJ23F0901072 | Certificate of Analysis | Sep 18, 2023 | rp144864 |
