| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp144868-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $139.90 | |
| rp144868-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $429.90 | |
| rp144868-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $769.90 | |
| rp144868-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,999.90 |
Animal Free, >97%( SDS-PAGE and HPLC), Active, E.coli, No tag, 59-128 aa
| Product Name | Recombinant Human CXCL7/PBP Protein, ＞97%( SDS-PAGE and HPLC), high purity |
|---|---|
| Synonyms | Beta-TG; Connective tissue-activating peptide III; CTAP III; CTAP3CTAP-III; CTAPIII; CXC chemokine ligand 7; C-X-C motif chemokine 7; CXCL7; CXCL7b-TG1; LA-PF4; LDGFTC1; Leukocyte-derived growth factor; Low-affinity platelet factor IV; Macrophage-derived |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) |
| Purity | ＞97%( SDS-PAGE and HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration range of 1.0-10.0 ng/ml. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | E. coli |
| Species | Human |
| Amino Acids | 59-128 aa |
| Sequence | AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
| Protein Tag | No tag |
| Accession # | P02775 |
| Predicted molecular weight | 7.6 kDa |
| SDS-PAGE | 7.6 kDa |
Recombinant Human CXCL7/PBP Protein (rp144868)-Protein Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration range of 1.0-10.0 ng/mL.
Recombinant Human CXCL7/PBP Protein (rp144868)-SDS-PAGE
Recombinant Human CXCL7/PBP Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 7.6 kDa under reducing conditions and 9.2-14.4 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. |
| Storage Temp | Store at -20°C |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Upon delivery aliquot, Store at -20°C, Avoid freeze/thaw cycles. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600422 | Certificate of Analysis | Mar 26, 2024 | rp144868 |
| ZJ23F0600423 | Certificate of Analysis | Mar 26, 2024 | rp144868 |
| ZJ23F0600424 | Certificate of Analysis | Mar 26, 2024 | rp144868 |
| 1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P et al.. (2004) The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res, 14 (10B): (2121-7). [PMID:15489334] |
| 2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K et al.. (2004) Complete sequencing and characterization of 21,243 full-length human cDNAs.. Nat Genet, 36 (1): (40-5). [PMID:14702039] |
| 3. Begg, G S GS, Pepper, D S DS, Chesterman, C N CN and Morgan, F J FJ.. (1978) Complete covalent structure of human beta-thromboglobulin.. Biochemistry, (2): [PMID:77677] |
| 4. Majumdar, S S, Gonder, D D, Koutsis, B B and Poncz, M M.. (1991) Characterization of the human beta-thromboglobulin gene. Comparison with the gene for platelet factor 4.. The Journal of biological chemistry, (25): [PMID:1826003] |
| 5. Clark-Lewis, I I and 5 more authors.. (1991) Chemical synthesis, purification, and characterization of two inflammatory proteins, neutrophil activating peptide 1 (interleukin-8) and neutrophil activating peptide.. Biochemistry, (26): [PMID:2007144] |
| 6. Walz, A A and Baggiolini, M M.. (1990) Generation of the neutrophil-activating peptide NAP-2 from platelet basic protein or connective tissue-activating peptide III through monocyte proteases.. The Journal of experimental medicine, (1): [PMID:2406364] |
| 7. Holt, J C JC and 5 more authors.. (1986) Characterization of human platelet basic protein, a precursor form of low-affinity platelet factor 4 and beta-thromboglobulin.. Biochemistry, (22): [PMID:2423119] |
| 8. Walz, A A and Baggiolini, M M.. (1989) A novel cleavage product of beta-thromboglobulin formed in cultures of stimulated mononuclear cells activates human neutrophils.. Biochemical and biophysical research communications, (31): [PMID:2522778] |
| 9. Wenger, R H RH, Wicki, A N AN, Walz, A A, Kieffer, N N and Clemetson, K J KJ.. (1989) Cloning of cDNA coding for connective tissue activating peptide III from a human platelet-derived lambda gt11 expression library.. Blood, (1): [PMID:2713489] |
| 10. Castor, C W CW and 7 more authors.. (1989) Connective tissue activation. XXXIII. Biologically active cleavage products of CTAP-III from human platelets.. Biochemical and biophysical research communications, (15): [PMID:2783111] |
| 11. Castor, C W CW, Miller, J W JW and Walz, D A DA.. (1983) Structural and biological characteristics of connective tissue activating peptide (CTAP-III), a major human platelet-derived growth factor.. Proceedings of the National Academy of Sciences of the United States of America, [PMID:6572368] |
| 12. Malkowski, M G MG, Wu, J Y JY, Lazar, J B JB, Johnson, P H PH and Edwards, B F BF.. (1995) The crystal structure of recombinant human neutrophil-activating peptide-2 (M6L) at 1.9-A resolution.. The Journal of biological chemistry, (31): [PMID:7706245] |
| 13. Ehlert, J E JE and 5 more authors.. (1995) Limited and defined truncation at the C terminus enhances receptor binding and degranulation activity of the neutrophil-activating peptide 2 (NAP-2). Comparison of native and recombinant NAP-2 variants.. The Journal of biological chemistry, (17): [PMID:7890771] |
| 14. Kungl, A J AJ and 8 more authors.. (1994) Purification, crystallization and preliminary X-ray diffraction analysis of recombinant human neutrophil-activating peptide 2 (rhNAP-2).. FEBS letters, (27): [PMID:8034022] |
| 15. Piccardoni, P P and 5 more authors.. (1996) Thrombin-activated human platelets release two NAP-2 variants that stimulate polymorphonuclear leukocytes.. Thrombosis and haemostasis, [PMID:8950790] |
| 16. Ehlert, J E JE, Gerdes, J J, Flad, H D HD and Brandt, E E.. (1998) Novel C-terminally truncated isoforms of the CXC chemokine beta-thromboglobulin and their impact on neutrophil functions.. Journal of immunology (Baltimore, Md. : 1950), (1): [PMID:9794434] |
| 17. Krijgsveld, J J and 11 more authors.. (2000) Thrombocidins, microbicidal proteins from human blood platelets, are C-terminal deletion products of CXC chemokines.. The Journal of biological chemistry, (7): [PMID:10877842] |
| 18. Zhang, C C and 7 more authors.. (2001) Localization of distal regulatory domains in the megakaryocyte-specific platelet basic protein/platelet factor 4 gene locus.. Blood, (1): [PMID:11468158] |
| 19. Gevaert, Kris K and 6 more authors.. (2003) Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.. Nature biotechnology, [PMID:12665801] |
| 20. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161] |
| 21. Hillier, Ladeana W LW and 121 more authors.. (2005) Generation and annotation of the DNA sequences of human chromosomes 2 and 4.. Nature, (7): [PMID:15815621] |
| 22. Bian, Yangyang Y and 9 more authors.. (2014) An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.. Journal of proteomics, (16): [PMID:24275569] |
