| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp144872-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $69.90 | |
| rp144872-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $329.90 | |
| rp144872-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $599.90 | |
| rp144872-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,999.90 |
Animal Free, >97%( SDS-PAGE and HPLC), Active, E.coli, No tag, 23-125 aa
| Product Name | Recombinant Human CXCL9 Protein, ＞97% (SDS-PAGE), high purity |
|---|---|
| Synonyms | Chemokine (C-X-C motif) ligand 9; CMK; crg-10; C-X-C motif chemokine 9; CXCL9; Gamma-interferon-induced monokine; Humig; MIG; MIGSmall-inducible cytokine B9; monokine induced by gamma interferon; SCYB9Monokine induced by interferon-gamma; Recombinant Huma |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, 高性能 |
| Product Description | Purity >97% SDS-PAGE. Purity is greater than 97% as determined by reducing SDS-PAGE Function Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3. CXCL9, a member of the alpha subfamily of chemokines that lack the ELR domain, was initially identified as a lymphokine-activated gene in mouse macrophages. Human CXCL9 was subsequently cloned using mouse MIG cDNA as a probe. The CXCL9 gene is induced in macrophages and in primary glial cells of the central nervous system specifically in response to IFN-gamma. CXCL9 has been shown to be a chemoattractant for activated T‑lymphocytes and TIL but not for neutrophils or monocytes. The human CXCL9 cDNA encodes a 125 amino acid residue precursor protein with a 22 amino acid residue signal peptide that is cleaved to yield a 103 amino acid residue mature protein. CXCL9 has an extended carboxy‑terminus containing greater than 50% basic amino acid residues and is larger than most other chemokines. The carboxy‑terminal residues of CXCL9 are prone to proteolytic cleavage resulting in size heterogeneity of natural and recombinant CXCL9. CXCL9 with large carboxy‑terminal deletions have been shown to have diminished activity in the calcium flux assay. A chemokine receptor (CXCR3) specific for CXCL9 and IP-10 has been cloned and shown to be highly expressed in IL-2-activated T‑lymphocytes. The E. coli‑expressed CXCL9 preparations produced at R&D Systems have been shown to contain greater than 80% full length CXCL9. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC) |
| Purity | ＞97% (SDS-PAGE) |
| Bioactivity | Measured by its ability to chemoattract BaF3 mouse pro‑B cells transfected with mouse CXCR3. The ED₅₀ for this effect is 0.1‑0.4 µg/mL. |
| Endotoxin Concentration | <0.01 EU/µg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 23-125 aa |
| Sequence | TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
| Protein Tag | No tag |
| Accession # | Q07325.1 |
| Predicted molecular weight | 11.7 kDa |
| SDS-PAGE | 16.8 kDa, under reducing conditions. |
Recombinant Human CXCL9 Protein (rp144872)-Protein Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10-100 ng/mL.
Recombinant Human CXCL9 Protein (rp144872)-SDS-PAGE
Recombinant Human CXCL9 Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a single band at 16.8 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water , aliquot and store at -80°C for 12 months or +4°C for 1 week. Avoid repeated freeze-thaw. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Upon delivery aliquot, Store at -20°C, Avoid freeze / thaw cycles. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600385 | Certificate of Analysis | Mar 26, 2024 | rp144872 |
| ZJ23F0600386 | Certificate of Analysis | Mar 26, 2024 | rp144872 |
| ZJ23F0600387 | Certificate of Analysis | Mar 26, 2024 | rp144872 |
| 1. and Farber, J M JM.. (1993) HuMig: a new human member of the chemokine family of cytokines.. Biochemical and biophysical research communications, (15): [PMID:8476424] |
| 2. Tensen, C P CP and 8 more authors.. (1999) Human IP-9: A keratinocyte-derived high affinity CXC-chemokine ligand for the IP-10/Mig receptor (CXCR3).. The Journal of investigative dermatology, [PMID:10233762] |
