Recombinant Human Cyclin D1 Protein, >95% (SDS-PAGE), high purity

Item Number

rp156643

• Product Name: Recombinant Human Cyclin D1 Protein, >95% (SDS-PAGE), high purity
• Synonyms: AI327039 | B cell CLL/lymphoma 1 | B cell leukemia 1 | B cell lymphoma 1 protein | B-cell lymphoma 1 protein | BCL 1 | BCL-1 | BCL-1 oncogene | BCL1 | BCL1 oncogene | ccnd1 | CCND1/FSTL3 fusion gene | CCND1/FSTL3 fusion gene, included | CCND1/IGHG1 fusion
• Grade: Azide Free, Carrier Free
• Specifications & Purity: Carrier Free, Azide Free, ≥95%(SDS-PAGE)
• Purity: >95% (SDS-PAGE)
• Expression System: E. coli
• Amino Acids: 1-295 aa
• Sequence: MGHHHHHHMEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRAC
• Protein Tag: N-His
• Predicted molecular weight: 34.7 kDa
• SDS-PAGE: 33.5 kDa, under reducing conditions

Product Description

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Regulatory component of the cyclin D1-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G1/S transition (PubMed:1833066, PubMed:1827756, PubMed:8114739, PubMed:8302605, PubMed:19412162, PubMed:33854235).
Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G1 phase (PubMed:1833066, PubMed:1827756, PubMed:8114739, PubMed:8302605, PubMed:19412162).
Hypophosphorylates RB1 in early G1 phase (PubMed:1833066, PubMed:1827756, PubMed:8114739, PubMed:8302605, PubMed:19412162).
Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals (PubMed:1833066, PubMed:1827756, PubMed:8302605, PubMed:19412162).
Also a substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity (PubMed:15241418).
Component of the ternary complex, cyclin D1/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (PubMed:9106657).
Exhibits transcriptional corepressor activity with INSM1 on the NEUROD1 and INS promoters in a cell cycle-independent manner (PubMed:16569215, PubMed:18417529).