| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp189612-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free! | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $59.90 | |
| rp189612-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
| rp189612-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $229.90 | |
| rp189612-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $1,999.90 |
Carrier Free, ≥95% (SDS-PAGE), E. coli, N-His tag, 2-165 aa
| Product Name | Recombinant Human Cyclophilin A Protein |
|---|---|
| Synonyms | Cyclosporin A-binding protein | CYPA | CYPAMGC12404 | CYPH | EC 5.2.1.8 | MGC117158 | MGC23397 | peptidyl-prolyl cis-trans isomerase A | Cyclophilin A | peptidylprolyl isomerase A (cyclophilin A) | PPIA | PPIase A | Rotamase A | Rotamase | T cell cyclophi |
| Grade | Carrier Free |
| Product Description | Cyclophilin A, also called Peptidyl-prolyl Isomerase A, PPIA, CYPA, and CYPH, was originally characterized for its ability to catalyze the transition between cis- and trans-proline residues critical for proper folding of proteins. Cyclophilin is also incorporated into many viruses, including HIV-1, where it has been speculated to be involved in functions such as viral assembly and infectivity. The immunosuppressive activity of cyclosporins has been correlated with their ability to form complexes with cyclophilins that inhibit calcineurin phosphatase activity and prevent incorporation of cyclophilin into viral particles. The cyclosporin/cyclophilin complex selectively binds and inactivates calcineurin, making it a useful inhibitor for studying calcineurin activity. |
| Specifications & Purity | Carrier Free, ≥95%(SDS-PAGE), See COA |
| Bioactivity | Testing in progress |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | E. coli |
| Amino Acids | 2-165 aa |
| Sequence | MGSSHHHHHHSSGLVPRGSHMVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE |
| Protein Tag | N-His |
| Predicted molecular weight | 20.0 kDa |
| SDS-PAGE | 18.5 kDa, under reducing conditions; 18.5 kDa, under non-reducing conditions |
Recombinant Human Cyclophilin A Protein (rp189612) - SDS-PAGE
3 μg/lane of Recombinant Human Cyclophilin A Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 18.5 kDa.
| Concentration | See COA |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Chart | Certificate Type | Date | Item |
|---|---|---|---|---|
 ZJ24F0708548 | Certificate of Analysis | Jul 19, 2024 | rp189612 | |
| ZJ24F0708547 | Certificate of Analysis | Jul 19, 2024 | rp189612 | |
| ZJ24F0708546 | Certificate of Analysis | Jul 19, 2024 | rp189612 | |
| ZJ24F0708545 | Certificate of Analysis | Jul 19, 2024 | rp189612 |
