Recombinant Human Cystatin A Protein

Item Number

rp183667

• Product Name: Recombinant Human Cystatin A Protein
• Grade: Carrier Free
• Specifications & Purity: Carrier Free, ≥95%(SDS-PAGE)
• Bioactivity: Testing in progress
• Endotoxin Concentration: <1 EU/μg
• Expression System: E. coli
• Amino Acids: 2-98 aa
• Sequence: MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
• Protein Tag: N-His
• Predicted molecular weight: 11.8 kDa
• SDS-PAGE: 12.2 kDa, under reducing conditions; 12.2 kDa, under non-reducing conditions

Product Description

Protein Function:：
Cystatin-A, also known as Cystatin-AS, Stefin-A and CSTA, is a cytoplasm protein which belongs to thecystatin family. Cystatin-A / CSTA is a cysteine proteinase inhibitor with a molecular mass of 11 kDa, and is located mainly in the keratohyaline granules of the stratum granulosum and the cornified envelope of the stratum corneum in the epidermis. The cystatins are a family of cysteine protease inhibitors with homology to chicken cystatin. Cystatins are physiological inhibitors of cysteine proteinases which are widely distributed in human tissues and fluids. Cystatins typically comprise about 115 amino acids, are largely acidic, contain four conserved cysteine residues known to form two disulfide bonds. Cystatins may be glycosylated and / or phosphorylated, with similarity to fetuins, kininogens, stefins, histidine-rich glycoproteins and cystatin-related proteins. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired inhibitory activity. Cystatins mainly inhibit peptidases belonging to peptidase families C1 (papain family) and C13 (legumain family).