My Cart
You have no items in your shopping cart.
SKU | Size | Availability | Price | Qty |
---|---|---|---|---|
rp144941-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $139.90 | |
rp144941-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $419.90 | |
rp144941-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $669.90 | |
rp144941-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $4,899.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 20-145 aa
Product Name | Recombinant Human Cystatin F Protein |
---|---|
Synonyms | CMAP | Cystatin-7 | Cystatin-like metastasis-associated protein | Leukocystatin | CMAP | CST7 | Cystatin 7 | cystatin F (leukocystatin) | Cystatin F | Cystatin-7 | cystatin-F | Cystatin-like metastasis-associated protein | Leukocystatin | CST7 | CMAP | Cy |
Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free |
Product Description | Function |
Specifications & Purity | Animal Free, Carrier Free, Bioactive, ActiBioPure™, ≥95%(SDS-PAGE) |
Bioactivity | Measured by its ability to inhibit active Cathepsin L cleavage of a fluorogenic peptide substrate Z-LR-AMC. The IC50 value is <6.0 nM, as measured under the described conditions. |
Endotoxin Concentration | <0.1 EU/μg |
Expression System | HEK293 |
Species | Human |
Amino Acids | 20-145 aa |
Sequence | GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCHHHHHHH |
Protein Tag | C-His |
Accession # | O76096 |
Predicted molecular weight | 15 kDa |
SDS-PAGE | 16&21&26 kDa, under reducing conditions |
Form | Lyophilized |
---|---|
Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
Shipped In | Ice chest + Ice pads |
Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
1. Deloukas P, Matthews LH, Ashurst J, Burton J, Gilbert JG, Jones M, Stavrides G, Almeida JP, Babbage AK, Bagguley CL, Bailey J, Barlow KF, Bates KN, Beard LM, Beare DM, Beasley OP, Bird CP, Blakey SE, Bridgeman AM, Brown AJ, Buck D, Burrill W, Butler AP, Carder C, Carter NP, Chapman JC, Clamp M, Clark G, Clark LN, Clark SY, Clee CM, Clegg S, Cobley VE, Collier RE, Connor R, Corby NR, Coulson A, Coville GJ, Deadman R, Dhami P, Dunn M, Ellington AG, Frankland JA, Fraser A, French L, Garner P, Grafham DV, Griffiths C, Griffiths MN, Gwilliam R, Hall RE, Hammond S, Harley JL, Heath PD, Ho S, Holden JL, Howden PJ, Huckle E, Hunt AR, Hunt SE, Jekosch K, Johnson CM, Johnson D, Kay MP, Kimberley AM, King A, Knights A, Laird GK, Lawlor S, Lehvaslaiho MH, Leversha M, Lloyd C, Lloyd DM, Lovell JD, Marsh VL, Martin SL, McConnachie LJ, McLay K, McMurray AA, Milne S, Mistry D, Moore MJ, Mullikin JC, Nickerson T, Oliver K, Parker A, Patel R, Pearce TA, Peck AI, Phillimore BJ, Prathalingam SR, Plumb RW, Ramsay H, Rice CM, Ross MT, Scott CE, Sehra HK, Shownkeen R, Sims S, Skuce CD, Smith ML, Soderlund C, Steward CA, Sulston JE, Swann M, Sycamore N, Taylor R, Tee L, Thomas DW, Thorpe A, Tracey A, Tromans AC, Vaudin M, Wall M, Wallis JM, Whitehead SL, Whittaker P, Willey DL, Williams L, Williams SA, Wilming L, Wray PW, Hubbard T, Durbin RM, Bentley DR, Beck S, Rogers J. (2001) The DNA sequence and comparative analysis of human chromosome 20.. Nature, 414 (6866): (865-71). [PMID:11780052] [10.1021/op500134e] |
2. Halfon, S S and 17 more authors.. (1998) Leukocystatin, a new Class II cystatin expressed selectively by hematopoietic cells.. The Journal of biological chemistry, (26): [PMID:9632704] |
3. Ni, J J and 8 more authors.. (1998) Cystatin F is a glycosylated human low molecular weight cysteine proteinase inhibitor.. The Journal of biological chemistry, (18): [PMID:9733783] |
4. Morita, M M, Hara, Y Y, Tamai, Y Y, Arakawa, H H and Nishimura, S S.. (2000) Genomic construct and mapping of the gene for CMAP (leukocystatin/cystatin F, CST7) and identification of a proximal novel gene, BSCv (C20orf3).. Genomics, (1): [PMID:10945474] |
5. Nathanson, Carl-Michael CM, Wassélius, Johan J, Wallin, Hanna H and Abrahamson, Magnus M.. (2002) Regulated expression and intracellular localization of cystatin F in human U937 cells.. European journal of biochemistry, [PMID:12423348] |
6. Schüttelkopf, Alexander W AW, Hamilton, Garth G, Watts, Colin C and van Aalten, Daan M F DM.. (2006) Structural basis of reduction-dependent activation of human cystatin F.. The Journal of biological chemistry, (16): [PMID:16601115] |