Recombinant Human Dkk-1 Protein

Item Number

rp181236

• Product Name: Recombinant Human Dkk-1 Protein
• Synonyms: dickkopf homolog 1 (Xenopus laevis) | dickkopf related protein-1 | Dickkopf-1 | dickkopf-related protein 1 | Dkk1 | Dkk-1 | hDkk-1 | SKdickkopf-1 like | dickkopf (Xenopus laevis) homolog 1
• Grade: ActiBioPure™, Animal Free, Bioactive, Carrier Free
• Specifications & Purity: ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥95%(SDS-PAGE)
• Bioactivity: Immobilized Recombinant Human Dkk-1 Protein (rp181236) at 1.0 μg/mL can bind Recombinant DKK1 Antibody (Ab099940) with the EC50 of 5.57 ng/mL.
• Endotoxin Concentration: ＜1.0 EU/μg
• Expression System: HEK293
• Amino Acids: 2-266 aa
• Sequence: MALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASN
• Protein Tag: C-His
• Predicted molecular weight: 26.6 kDa
• SDS-PAGE: 37.3-47.6 kDa, under reducing conditions; 42.4-60.6 kDa, under non-reducing conditions

Product Description

Protein Function:

Dickkopf related protein 1 (Dkk-1) is the founding member of the Dickkopf family of proteins that includes Dkk-1, -2, -3, -4, and a related protein, Soggy. Dkk proteins are secreted proteins that contain two conserved cysteine-rich domains separated by a linker region. Each domain contains ten cysteine residues. Mature human Dkk-1 is a 40 kDa glycosylated protein that shares 86%, 87%, 90%, and 91% aa sequence identity with mouse, rat, rabbit, and bovine Dkk-1, respectively. It also shares 42% and 36% aa identity with human Dkk-2 and Dkk-4, respectively. Dkk-1 and Dkk-4 are well-documented antagonists of the canonical Wnt signaling pathway. This pathway is activated by Wnt engagement of a receptor complex composed of the Frizzled proteins and one of two low-density lipoprotein receptor-related proteins, LRP5 or LRP6. Dkk-1 antagonizes Wnt by forming ternary complexes of LRP5/6 with Kremen1 or Kremen2. Dkk‑1/LRP6/Krm2 complex internalization has been shown to down-regulate Wnt signaling. Dkk-1 is expressed throughout development and antagonizes Wnt-7a during limb development. Other sites of expression include developing neurons, hair follicles, and the retina of the eye. The balance between Wnt signaling and Dkk-1 inhibition is critical for bone formation and homeostasis. Insufficient or excess Dkk-1 activity in bone results in increased or decreased bone density, respectively. In adults, Dkk-1 is expressed in osteoblasts and osteocytes, and neurons. Cerebral ischemia induces Dkk-1 expression, which contributes to neuronal cell death.