| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp145162-10μg | 10μg | In stock | $129.90 | |
| rp145162-50μg | 50μg | In stock | $359.90 | |
| rp145162-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $619.90 | |
| rp145162-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $3,079.90 |
Animal Free, >95% (SDS-PAGE), Active, HEK293, C-His tag, 22-540 aa
| Product Name | Recombinant Human DLL1 Protein, >95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | delta (Drosophila)-like 1; Delta 1; Delta; Delta1; delta-like 1 (Drosophila); delta-like protein 1; DL1; DLL1; Drosophila Delta homolog 1; H-Delta-1; DELTA1; NEDBAS |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High performance |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | >95% (SDS-PAGE) |
| Bioactivity | 1. Measured by its ability to bind human NOTCH1 in a functional ELISA. 2. Measured by the ability of the immobilized protein to enhance BMP2-induced alkaline phosphatase activity in C3H10T1/2 mouse embryonic fibroblast cells. The ED50 for this effect is t |
| Endotoxin Concentration | ＜1.0 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 22-540 aa |
| Sequence | SGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFFRVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGGGADSAFSNPIRFPFGFTWPGTFSLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCDEHYYGEGCSVFCRPRDDAFGHFTCGERGEKVCNPGWKGPYCTEPICLPGCDEQHGFCDKPGECKCRVGWQGRYCDECIRYPGCLHGTCQQPWQCNC |
| Protein Tag | C-His |
| Accession # | O00548 |
| Predicted molecular weight | 57.4 kDa |
| SDS-PAGE | 58 kDa, under reducing conditions |
Recombinant Human DLL1 protein (rp145162) - Protein Bioactivity
Measured by the ability of the immobilized protein to enhance BMP2-induced alkaline phosphatase activity in C3H10T1/2 mouse embryonic fibroblast cells. The ED₅₀ for this effect is typically 2 - 20 μg/mL.
Recombinant Human DLL1 protein (rp145162) - Protein Bioactivity
Measured by its ability to bind human NOTCH1 in a functional ELISA. Immobilized Recombinant Human DLL1 protein (rp145162) at 2 μg/mL can bind human NOTCH1.
Recombinant Human DLL1 protein (rp145162) - SDS-PAGE
3 μg/lane of Recombinant Human DLL1 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 61.1 kDa.
| Form | Lyophilized |
|---|---|
| Reconstitution | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25mg/mL. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store it under sterile conditions at -20℃ to -80℃. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0102358 | Certificate of Analysis | Feb 04, 2024 | rp145162 |
| ZJ24F0102357 | Certificate of Analysis | Jan 25, 2024 | rp145162 |
| ZJ24F0102356 | Certificate of Analysis | Jan 25, 2024 | rp145162 |
| 1. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C et al.. (2003) The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.. Genome Res, 13 (10): (2265-70). [PMID:12975309] |
| 2. Gray, G E GE and 9 more authors.. (1999) Human ligands of the Notch receptor.. The American journal of pathology, [PMID:10079256] |
| 3. Han, W W, Ye, Q Q and Moore, M A MA.. (2000) A soluble form of human Delta-like-1 inhibits differentiation of hematopoietic progenitor cells.. Blood, (1): [PMID:10688816] |
| 4. Shimizu, K K, Chiba, S S, Saito, T T, Kumano, K K and Hirai, H H.. (2000) Physical interaction of Delta1, Jagged1, and Jagged2 with Notch1 and Notch3 receptors.. Biochemical and biophysical research communications, (16): [PMID:11006133] |
| 5. Jaleco, A C AC and 7 more authors.. (2001) Differential effects of Notch ligands Delta-1 and Jagged-1 in human lymphoid differentiation.. The Journal of experimental medicine, (1): [PMID:11581320] |
| 6. Wright, Gavin J GJ, Leslie, Jonathan D JD, Ariza-McNaughton, Linda L and Lewis, Julian J.. (2004) Delta proteins and MAGI proteins: an interaction of Notch ligands with intracellular scaffolding molecules and its significance for zebrafish development.. Development (Cambridge, England), [PMID:15509766] |
| 7. Wang, Pingzhang P, Yu, Peng P, Gao, Peng P, Shi, Taiping T and Ma, Dalong D.. (2009) Discovery of novel human transcript variants by analysis of intronic single-block EST with polyadenylation site.. BMC genomics, (12): [PMID:19906316] |
| 8. Adam, M Gordian MG and 10 more authors.. (2013) Synaptojanin-2 binding protein stabilizes the Notch ligands DLL1 and DLL4 and inhibits sprouting angiogenesis.. Circulation research, (8): [PMID:24025447] |
| 9. Suzuki, Ikuo K IK and 11 more authors.. (2018) Human-Specific NOTCH2NL Genes Expand Cortical Neurogenesis through Delta/Notch Regulation.. Cell, (31): [PMID:29856955] |
| 10. Fischer-Zirnsak, Björn B and 37 more authors.. (2019) Haploinsufficiency of the Notch Ligand DLL1 Causes Variable Neurodevelopmental Disorders.. American journal of human genetics, (19): [PMID:31353024] |
