| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp143887-10μg | 10μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $99.90 | |
| rp143887-50μg | 50μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $419.90 | |
| rp143887-100μg | 100μg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $649.90 | |
| rp143887-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,599.90 |
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-hFc&His tag, 19-247 aa
| Product Name | Recombinant Human DNAM-1/CD226 Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free |
| Product Description | Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human CD226 at 2 μg/mL (100 μL/well) can bind Recombinant Human CD155 with a linear range of 0.3-1.2 μg/mL. |
| Endotoxin Concentration | ＜0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 19-247 aa |
| Sequence | EEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTVAEGKTDNENLYFQGMDPKSCDKTHTCPPCPAPE |
| Protein Tag | C-hFc & His |
| Accession # | Q15762 |
| Predicted molecular weight | 54 kDa |
| SDS-PAGE | 80-90 kDa, under reducing conditions |
Recombinant Human DNAM-1/CD226 Protein (rp143887) - Protein Bioactivity
Immobilized Recombinant Human DNAM-1/CD226 Protein (rp143887) at 4.0 μg/mL can bind Biotinylated Human CD155 with a linear range of 0.02 - 0.625 μg/mL. The ED
₅₀
for this effect is 0.90 μg/mL.
Recombinant Human DNAM-1/CD226 Protein (rp143887) - SDS-PAGE
3 μg/lane of Recombinant Human DNAM-1/CD226 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 80.0 kDa under reducing conditions and 80.0 & 160.0 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon delivery aliquot. Avoid freeze/thaw cycle. |
Enter Lot Number to search for COA:
To view the certificate results,please click on a Lot number.For Lot numbers from past orders,please use our order status section
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ24F0606788 | Certificate of Analysis | Jun 14, 2024 | rp143887 |
| ZJ24F0606787 | Certificate of Analysis | Jun 14, 2024 | rp143887 |
| ZJ24F0606786 | Certificate of Analysis | Jun 14, 2024 | rp143887 |
| 1. Zhu Y, Paniccia A, Schulick AC, Chen W, Koenig MR, Byers JT, Yao S, Bevers S, Edil BH. (2016) Identification of CD112R as a novel checkpoint for human T cells.. J Exp Med, 213 (2): (167-76). [PMID:26755705] |
| 2. Shibuya, A A and 10 more authors.. (1996) DNAM-1, a novel adhesion molecule involved in the cytolytic function of T lymphocytes.. Immunity, [PMID:8673704] |
| 3. Tahara-Hanaoka, Satoko S and 8 more authors.. (2004) Functional characterization of DNAM-1 (CD226) interaction with its ligands PVR (CD155) and nectin-2 (PRR-2/CD112).. International immunology, [PMID:15039383] |
| 4. Pende, Daniela D and 13 more authors.. (2005) PVR (CD155) and Nectin-2 (CD112) as ligands of the human DNAM-1 (CD226) activating receptor: involvement in tumor cell lysis.. Molecular immunology, [PMID:15607800] |
| 5. Nusbaum, Chad C and 54 more authors.. (2005) DNA sequence and analysis of human chromosome 18.. Nature, (22): [PMID:16177791] |
| 6. Zahedi, René P RP and 8 more authors.. (2008) Phosphoproteome of resting human platelets.. Journal of proteome research, [PMID:18088087] |
