Skip to the beginning of the images gallery

Recombinant Human Doublecortin Protein, ＞90% (SDS-PAGE), high purity

Carrier Free

Azide Free

≥90%(SDS-PAGE)

Features and benefits

Expression System: E. coli
Accession #: O43602
Protein Tag: N-His

Item Number

rp156657

Grouped product items
SKU	Size	Availability	Price
rp156657-10μg (Trial Size) Apply for free trial size（?） Every year, as a valued customer, you have the exclusive opportunity to explore and enjoy three different trial products of your choice, absolutely free!	10μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$199.90
rp156657-100μg	100μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$549.90
rp156657-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,339.90

Carrier free , >90% (SDS-PAGE), E.coli, N-His tag, 40-150 aa

View related series

Click to view protein information: DCX

Accession#:O43602 DCX Doublecortin Gene ID:1641

Basic Description

Product Name	Recombinant Human Doublecortin Protein, ＞90% (SDS-PAGE), high purity
Synonyms	Doublecortin,DCX,DBCN,LISX,Doublin,Lissencephalin-X(Lis-X),Neuronal migration protein doublecortin
Grade	Azide Free, Carrier Free
Product Description	Purity: >90%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description: DCX (doublecortin, N-GST chimera)contains 2 doublecortin domains and belongs to the doublecortin family. It is highly expressed in neuronal cells of fetal brain, but not expressed in other fetal tissues. In the adult, it is highly expressed in the brain frontal lobe, but very low expression in other regions of brain, and not detected in heart, placenta, lung, liver, skeletal muscles, kidney and pancreas. DCX is a microtubule-associated protein required for initial steps of neuronal dispersion and cortex lamination during cerebral cortex development. It may act by competing with the putative neuronal protein kinase DCAMKL1 in binding to a target protein. DCX may in that way participate in a signaling pathway that is crucial for neuronal interaction before and during migration, possibly as part of a calcium ion-dependent signal transduction pathway. It may be part with LIS-1 of a overlapping, but distinct, signaling pathways that promote neuronal migration. Defects in DCX are the cause of lissencephaly X-linked type 1 and subcortical band heterotopia X-linked.
Specifications & Purity	Carrier Free, Azide Free, ≥90%(SDS-PAGE)
Purity	＞90% (SDS-PAGE)
Expression System	E. coli
Species	Human
Amino Acids	40-150 aa
Sequence	MGHHHHHHALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNV
Protein Tag	N-His
Accession #	O43602
Predicted molecular weight	13.2 kDa
SDS-PAGE	13.2 kDa

Product Specifications

Form	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilu
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year, store at 2-8℃ for 1 month. Avoid freeze / thaw cycle.

Certificates

Certificate of Analysis(COA)

Enter Lot Number to search for COA:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot Number	Certificate Type	Date	Item
ZJ23F0700564	Certificate of Analysis	Jul 14, 2023	rp156657
ZJ23F0700582	Certificate of Analysis	Jul 14, 2023	rp156657

References

1. Kim MH, Cierpicki T, Derewenda U, Krowarsch D, Feng Y, Devedjiev Y, Dauter Z, Walsh CA, Otlewski J, Bushweller JH et al.. (2003) The DCX-domain tandems of doublecortin and doublecortin-like kinase.. Nat Struct Biol, 10 (5): (324-33). [PMID:12692530]
2. des Portes, V V and 13 more authors.. (1998) A novel CNS gene required for neuronal migration and involved in X-linked subcortical laminar heterotopia and lissencephaly syndrome.. Cell, (9): [PMID:9489699]
3. Gleeson, J G JG and 10 more authors.. (1998) Doublecortin, a brain-specific gene mutated in human X-linked lissencephaly and double cortex syndrome, encodes a putative signaling protein.. Cell, (9): [PMID:9489700]
4. des Portes, V V and 15 more authors.. (1998) doublecortin is the major gene causing X-linked subcortical laminar heterotopia (SCLH).. Human molecular genetics, [PMID:9618162]
5. Sossey-Alaoui, K K and 8 more authors.. (1998) Human doublecortin (DCX) and the homologous gene in mouse encode a putative Ca2+-dependent signaling protein which is mutated in human X-linked neuronal migration defects.. Human molecular genetics, [PMID:9668176]
6. Pilz, D T DT and 10 more authors.. (1998) LIS1 and XLIS (DCX) mutations cause most classical lissencephaly, but different patterns of malformation.. Human molecular genetics, [PMID:9817918]
7. Gleeson, J G JG and 24 more authors.. (1999) Characterization of mutations in the gene doublecortin in patients with double cortex syndrome.. Annals of neurology, [PMID:9989615]
8. Kato, M M and 7 more authors.. (1999) A novel mutation of the doublecortin gene in Japanese patients with X-linked lissencephaly and subcortical band heterotopia.. Human genetics, [PMID:10369164]
9. Pilz, D T DT and 7 more authors.. (1999) Subcortical band heterotopia in rare affected males can be caused by missense mutations in DCX (XLIS) or LIS1.. Human molecular genetics, [PMID:10441340]
10. Sakamoto, M M, Ono, J J, Okada, S S, Nakamura, Y Y and Kurahashi, H H.. (2000) Genetic alteration of the DCX gene in Japanese patients with subcortical laminar heterotopia or isolated lissencephaly sequence.. Journal of human genetics, [PMID:10807542]
11. Matsumoto, N N and 11 more authors.. (2001) Mutation analysis of the DCX gene and genotype/phenotype correlation in subcortical band heterotopia.. European journal of human genetics : EJHG, [PMID:11175293]
12. Demelas, L L and 10 more authors.. (2001) Incomplete penetrance with normal MRI in a woman with germline mutation of the DCX gene.. Neurology, (24): [PMID:11468322]
13. Kato, M M and 8 more authors.. (2001) Mutation of the doublecortin gene in male patients with double cortex syndrome: somatic mosaicism detected by hair root analysis.. Annals of neurology, [PMID:11601509]
14. des Portes, V V and 8 more authors.. (2002) So-called 'cryptogenic' partial seizures resulting from a subtle cortical dysgenesis due to a doublecortin gene mutation.. Seizure, [PMID:12027577]
15. D'Agostino, Maria Daniela MD and 31 more authors.. (2002) Subcortical band heterotopia (SBH) in males: clinical, imaging and genetic findings in comparison with females.. Brain : a journal of neurology, [PMID:12390976]
16. Aigner, L L and 14 more authors.. (2003) Somatic mosaicism and variable penetrance in doublecortin-associated migration disorders.. Neurology, (28): [PMID:12552055]
17. Ross, Mark T MT and 281 more authors.. (2005) The DNA sequence of the human X chromosome.. Nature, (17): [PMID:15772651]
18. Slepak, Tatiana I; Salay, Lindsey D; Lemmon, Vance P and Bixby, John L.. (2012) Dyrk kinases regulate phosphorylation of doublecortin, cytoskeletal organization, and neuronal morphology.. Cytoskeleton (Hoboken, N.J.), [PMID:22359282]
19. Homan, Claire C CC and 10 more authors.. (2014) Mutations in USP9X are associated with X-linked intellectual disability and disrupt neuronal cell migration and growth.. American journal of human genetics, (6): [PMID:24607389]
20. Tsai, Meng-Han MH and 9 more authors.. (2016) A novel DCX missense mutation in a family with X-linked lissencephaly and subcortical band heterotopia syndrome inherited from a low-level somatic mosaic mother: Genetic and functional studies.. European journal of paediatric neurology : EJPN : official journal of the European Paediatric Neurology Society, [PMID:27292316]

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Dilution Calculator

Determine the dilution needed to prepare a stock solution.