| SKU | Size | Availability | Price | Qty |
|---|---|---|---|---|
| rp145479-10μg | 10μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $69.90 | |
| rp145479-50μg | 50μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $329.90 | |
| rp145479-100μg | 100μg | Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience! | $499.90 | |
| rp145479-1mg | 1mg | Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding. | $2,999.90 |
Animal Free, >98% ( SDS-PAGE and HPLC), Active, E.coli, No tag, 20-105 aa
| Product Name | Recombinant Human EG-VEGF Protein, ＞98%(SDS-PAGE and HPLC), high purity |
|---|---|
| Synonyms | EGVEGF | EG-VEGF | EGVEGFblack mamba toxin-related protein | Endocrine-gland-derived vascular endothelial growth factor | Mambakine | PK1mambakine | PRK1prokineticin-1 | PROK1 | Prokineticin 1 | Black mamba toxin related protein | EG VEGF | PK1 | PRK1 | P |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description | Purity >98% SDS-PAGE. Additional sequence information Mature chain Function Potently contracts gastrointestinal (GI) smooth muscle. Induces proliferation, migration and fenestration (the formation of membrane discontinuities) in capillary endothelial cells derived from endocrine glands. Has little or no effect on a variety of other endothelial and non-endothelial cell types. Induces proliferation and differentiation, but not migration, of enteric neural crest cells. Directly influences neuroblastoma progression by promoting the proliferation and migration of neuroblastoma cells. Positively regulates PTGS2 expression and prostaglandin synthesis. May play a role in placentation. May play a role in normal and pathological testis angiogenesis. Endocrine gland-derived vascular endothelial growth factor (EG-VEGF), also called prokineticin 1 (PK1), is a member of the prokineticin family of secreted proteins that share a common structural motif containing ten conserved cysteine residues that form five pairs of disulfide bonds. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥98%(SDS-PAGE&HPLC) |
| Purity | ＞98%(SDS-PAGE and HPLC) |
| Bioactivity | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using bovine EJG cells is less than 2.0 μg/ml, corresponding to a specific activity of > 500 IU/mg. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | E.coli |
| Species | Human |
| Amino Acids | 20-105 aa |
| Sequence | AVITGACERDVQCGAGTCCAISLWLRGLRMCTPLGREGEECHPGSHKVPF FRKRKHHTCPCLPNLLCSRFPDGRYRCSMDLKNINF |
| Protein Tag | No tag |
| Protein Length | Full length protein |
| Accession # | P58294 |
| Source | Recombinant |
| Predicted molecular weight | 9.7 kDa |
| Note | 20μg卖完停产，不再备货 |
Recombinant Human EG-VEGF Protein (rp145479)-Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by a cell proliferation assay using bovine EJG cells is less than 2.0 μg/mL, corresponding to a specific activity of > 500 IU/mg.
Recombinant Human EG-VEGF Protein (rp145479)-SDS-PAGE
Recombinant Human EG-VEGF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining. Showing a band at 10.7 kDa under reducing conditions and 14.5-21.4 kDa under non-reducing conditions.
| Form | Lyophilized |
|---|---|
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Upon delivery aliquot, Store at -20°C, Avoid freeze / thaw cycles. Lyophilized with no additives. This product is an active protein and may elicit a biological response in vivo, handle with caution. |
Enter Lot Number to search for COA:
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
 ZJ23F0600359 | Certificate of Analysis | Mar 26, 2024 | rp145479 |
| ZJ23F0600360 | Certificate of Analysis | Mar 26, 2024 | rp145479 |
| ZJ23F0600361 | Certificate of Analysis | Mar 26, 2024 | rp145479 |
| 1. Li M, Bullock CM, Knauer DJ, Ehlert FJ, Zhou QY. (2001) Identification of two prokineticin cDNAs: recombinant proteins potently contract gastrointestinal smooth muscle.. Mol Pharmacol, 59 (13): (692-698). [PMID:11259612] |
| 2. LeCouter J, Kowalski J, Foster J, Hass P, Zhang Z, Dillard-Telm L, Frantz G, Rangell L, DeGuzman L, Keller GA et al.. (2001) Identification of an angiogenic mitogen selective for endocrine gland endothelium.. Nature, 412 (6850): (877-84). [PMID:11528470] |
| 3. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C et al.. (2003) The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.. Genome Res, 13 (10): (2265-70). [PMID:12975309] |
| 4. Evans J, Catalano RD, Morgan K, Critchley HO, Millar RP, Jabbour HN. (2008) Prokineticin 1 signaling and gene regulation in early human pregnancy.. Endocrinology, 149 (6): (2877-87). [PMID:18339712] |
| 5. Samson, Michel M and 5 more authors.. (2004) Human endocrine gland-derived vascular endothelial growth factor: expression early in development and in Leydig cell tumors suggests roles in normal and pathological testis angiogenesis.. The Journal of clinical endocrinology and metabolism, [PMID:15292351] |
| 6. Zhang, Zemin Z and Henzel, William J WJ.. (2004) Signal peptide prediction based on analysis of experimentally verified cleavage sites.. Protein science : a publication of the Protein Society, [PMID:15340161] |
| 7. Gregory, S G SG and 178 more authors.. (2006) The DNA sequence and biological annotation of human chromosome 1.. Nature, (18): [PMID:16710414] |
| 8. Ngan, Elly S W ES and 10 more authors.. (2007) Implications of endocrine gland-derived vascular endothelial growth factor/prokineticin-1 signaling in human neuroblastoma progression.. Clinical cancer research : an official journal of the American Association for Cancer Research, (1): [PMID:17289879] |
